BLASTX nr result
ID: Bupleurum21_contig00018496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018496 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281242.1| PREDICTED: probable S-acyltransferase At4g01... 80 2e-13 emb|CAN83141.1| hypothetical protein VITISV_035325 [Vitis vinifera] 80 2e-13 ref|XP_002874962.1| zinc finger family protein [Arabidopsis lyra... 74 1e-11 ref|XP_002535131.1| zinc finger protein, putative [Ricinus commu... 74 2e-11 gb|AAC72868.1| contains similarity to human DHHC-domain-containi... 73 2e-11 >ref|XP_002281242.1| PREDICTED: probable S-acyltransferase At4g01730 [Vitis vinifera] gi|297744084|emb|CBI37054.3| unnamed protein product [Vitis vinifera] Length = 506 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +1 Query: 61 VAASPKHRYKSSFDLKLTEVSQELETYISRQVVCSVLKDTGSEASPR 201 V SPKH+Y+S+FDLKLTEVS+ELETYISRQV+CSVLK GSEASPR Sbjct: 460 VVPSPKHKYRSNFDLKLTEVSRELETYISRQVLCSVLKKDGSEASPR 506 >emb|CAN83141.1| hypothetical protein VITISV_035325 [Vitis vinifera] Length = 968 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +1 Query: 61 VAASPKHRYKSSFDLKLTEVSQELETYISRQVVCSVLKDTGSEASPR 201 V SPKH+Y+S+FDLKLTEVS+ELETYISRQV+CSVLK GSEASPR Sbjct: 922 VVPSPKHKYRSNFDLKLTEVSRELETYISRQVLCSVLKKDGSEASPR 968 >ref|XP_002874962.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297320799|gb|EFH51221.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 508 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/51 (66%), Positives = 44/51 (86%) Frame = +1 Query: 49 TTGAVAASPKHRYKSSFDLKLTEVSQELETYISRQVVCSVLKDTGSEASPR 201 ++ + SPK +Y+S+FDLKLTEVS+ELE+YISRQV+CSV+K GSEASPR Sbjct: 458 SSSSTVPSPKQKYRSNFDLKLTEVSRELESYISRQVLCSVIKQDGSEASPR 508 >ref|XP_002535131.1| zinc finger protein, putative [Ricinus communis] gi|223523954|gb|EEF27251.1| zinc finger protein, putative [Ricinus communis] Length = 481 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +1 Query: 61 VAASPKHRYKSSFDLKLTEVSQELETYISRQVVCSVLKDTGSEASPR 201 V SPK +Y+SSFDLKLTEVS+ELETYISRQV+CSV+K+ EASPR Sbjct: 435 VVPSPKQKYRSSFDLKLTEVSKELETYISRQVLCSVIKNDACEASPR 481 >gb|AAC72868.1| contains similarity to human DHHC-domain-containing cysteine-rich protein (GB:U90653) and several S. cerevisiae probable membrane proteins (GB:U20865, Z48758, U43491) [Arabidopsis thaliana] Length = 513 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/51 (64%), Positives = 44/51 (86%) Frame = +1 Query: 49 TTGAVAASPKHRYKSSFDLKLTEVSQELETYISRQVVCSVLKDTGSEASPR 201 ++ + SPK +Y+++FDLKLTEVS+ELE+YISRQV+CSV+K GSEASPR Sbjct: 463 SSSSTVPSPKQKYRTNFDLKLTEVSRELESYISRQVLCSVIKQDGSEASPR 513