BLASTX nr result
ID: Bupleurum21_contig00018406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018406 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517608.1| Disease resistance protein RPS2, putative [R... 57 2e-06 >ref|XP_002517608.1| Disease resistance protein RPS2, putative [Ricinus communis] gi|223543240|gb|EEF44772.1| Disease resistance protein RPS2, putative [Ricinus communis] Length = 1658 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/82 (37%), Positives = 51/82 (62%) Frame = -2 Query: 314 LNASNCGLLEYVVKDTKNDEISEANDKIITLSQLWSIELENLPNLKSFSRTSSYAFDMPK 135 L SNC ++ ++ + ++D+ EA D I L +L ++ +ENLP+L++F R Y F+MP Sbjct: 1536 LKISNCKMIMEII-EKEDDKEHEAADNKIELPELRNLTMENLPSLEAFYR-GIYDFEMPS 1593 Query: 134 LSHFNLLQCPQVENFTYLKTST 69 L L+ CP+++ FTY ST Sbjct: 1594 LDKLILVGCPKMKIFTYKHVST 1615