BLASTX nr result
ID: Bupleurum21_contig00018405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018405 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517608.1| Disease resistance protein RPS2, putative [R... 55 6e-06 >ref|XP_002517608.1| Disease resistance protein RPS2, putative [Ricinus communis] gi|223543240|gb|EEF44772.1| Disease resistance protein RPS2, putative [Ricinus communis] Length = 1658 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/78 (35%), Positives = 50/78 (64%) Frame = -2 Query: 265 NCRLLEYVVKDTKNDEISEANDKIITLSQLLVIKLENLPNLKSFGRTSSYAFDMPKLSHF 86 NC+++ ++ + ++D+ EA D I L +L + +ENLP+L++F R Y F+MP L Sbjct: 1540 NCKMIMEII-EKEDDKEHEAADNKIELPELRNLTMENLPSLEAFYR-GIYDFEMPSLDKL 1597 Query: 85 IMLQCPQVESFSYPKTST 32 I++ CP+++ F+Y ST Sbjct: 1598 ILVGCPKMKIFTYKHVST 1615