BLASTX nr result
ID: Bupleurum21_contig00018128
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018128 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589833.1| Protein kinase [Medicago truncatula] gi|3554... 89 5e-16 ref|XP_002327722.1| predicted protein [Populus trichocarpa] gi|2... 86 4e-15 ref|XP_003589834.1| Protein kinase-like protein [Medicago trunca... 73 2e-11 ref|XP_003589832.1| hypothetical protein MTR_1g040060 [Medicago ... 73 2e-11 ref|XP_003589847.1| Protein kinase-like protein [Medicago trunca... 73 3e-11 >ref|XP_003589833.1| Protein kinase [Medicago truncatula] gi|355478881|gb|AES60084.1| Protein kinase [Medicago truncatula] Length = 188 Score = 88.6 bits (218), Expect = 5e-16 Identities = 47/69 (68%), Positives = 57/69 (82%), Gaps = 2/69 (2%) Frame = +3 Query: 3 IGGVCQAKAVVQHLGDT*SPQ*QAIVVRL--PP*KINLISCEPMVHISDIKLIRTDTTLD 176 IGGV QA A+VQH G+T +A+++++ PP K NLISCEP+VH+SDIKLIRTDTTLD Sbjct: 113 IGGVRQANAIVQHTGNTR----EALLLKMASPPRKSNLISCEPLVHVSDIKLIRTDTTLD 168 Query: 177 LSQKAEKGM 203 LSQKAEKGM Sbjct: 169 LSQKAEKGM 177 >ref|XP_002327722.1| predicted protein [Populus trichocarpa] gi|222836807|gb|EEE75200.1| predicted protein [Populus trichocarpa] Length = 95 Score = 85.5 bits (210), Expect = 4e-15 Identities = 43/77 (55%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = -3 Query: 232 YSQNQTSQIS-IPFSAFWLRXXXXXXXXXXXSDMWTIGSHDIKFIF*GGSLTTIACYWGL 56 Y + TS S IPFSAFWLR SD W GSHDIKFIF GG T+ACYWG Sbjct: 8 YKRKLTSAESVIPFSAFWLRSSVVSVLISLISDTWANGSHDIKFIFLGGGSITVACYWGS 67 Query: 55 QVSPKCCTTALAWHTPP 5 + SP CT ALAW +PP Sbjct: 68 RASPLRCTIALAWRSPP 84 >ref|XP_003589834.1| Protein kinase-like protein [Medicago truncatula] gi|357439123|ref|XP_003589838.1| Protein kinase-like protein [Medicago truncatula] gi|355478882|gb|AES60085.1| Protein kinase-like protein [Medicago truncatula] gi|355478886|gb|AES60089.1| Protein kinase-like protein [Medicago truncatula] Length = 69 Score = 73.2 bits (178), Expect = 2e-11 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +3 Query: 72 AIVVRLPP*KINLISCEPMVHISDIKLIRTDTTLDLSQKAEKGM 203 A V PP K NLISCEP+VHISDIKLIRTDTTLDLSQKAEKGM Sbjct: 25 ATKVASPPQKSNLISCEPLVHISDIKLIRTDTTLDLSQKAEKGM 68 >ref|XP_003589832.1| hypothetical protein MTR_1g040060 [Medicago truncatula] gi|355478880|gb|AES60083.1| hypothetical protein MTR_1g040060 [Medicago truncatula] Length = 56 Score = 73.2 bits (178), Expect = 2e-11 Identities = 37/45 (82%), Positives = 38/45 (84%) Frame = +3 Query: 69 QAIVVRLPP*KINLISCEPMVHISDIKLIRTDTTLDLSQKAEKGM 203 QA V PP K NLISCEP+VHI DIKLIRTDTTLDLSQKAEKGM Sbjct: 11 QATEVASPPQKSNLISCEPLVHIPDIKLIRTDTTLDLSQKAEKGM 55 >ref|XP_003589847.1| Protein kinase-like protein [Medicago truncatula] gi|355478895|gb|AES60098.1| Protein kinase-like protein [Medicago truncatula] Length = 60 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +3 Query: 81 VRLPP*KINLISCEPMVHISDIKLIRTDTTLDLSQKAEKGM 203 V PP K NLISCEP+VHISDIKLIRTDTTLDLSQKAEKGM Sbjct: 19 VASPPQKSNLISCEPLVHISDIKLIRTDTTLDLSQKAEKGM 59