BLASTX nr result
ID: Bupleurum21_contig00018125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018125 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 82 6e-14 gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tab... 81 1e-13 dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas] 80 2e-13 ref|XP_004150764.1| PREDICTED: calcium-dependent protein kinase ... 79 3e-13 ref|XP_002283549.2| PREDICTED: calcium-dependent protein kinase ... 79 3e-13 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/49 (77%), Positives = 45/49 (91%) Frame = -3 Query: 264 RISYDEFSAMMKSGTDWRKASRQYSRVRYNNLSLSLMRDGSVKVKDEIR 118 RISYDEF+AMMK+GTDWRKASRQYSR R+NNLSL LMRDGS+++ +E R Sbjct: 486 RISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMRDGSLQMNNEGR 534 >gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum] Length = 530 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = -3 Query: 264 RISYDEFSAMMKSGTDWRKASRQYSRVRYNNLSLSLMRDGSVKVKDEIR 118 RISYDEFS MMK+GTDWRKASRQYSR RYN+LSL LM+DGS+++ +E R Sbjct: 482 RISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGSLQMSNETR 530 >dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas] Length = 531 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/49 (71%), Positives = 45/49 (91%) Frame = -3 Query: 264 RISYDEFSAMMKSGTDWRKASRQYSRVRYNNLSLSLMRDGSVKVKDEIR 118 RISYDEF+ MMK+GTDWRKASRQYSR R++NLSL LM+DGS+++ +E+R Sbjct: 483 RISYDEFATMMKAGTDWRKASRQYSRERFSNLSLKLMKDGSLQLNNEVR 531 >ref|XP_004150764.1| PREDICTED: calcium-dependent protein kinase 7-like [Cucumis sativus] gi|449508351|ref|XP_004163290.1| PREDICTED: calcium-dependent protein kinase 7-like [Cucumis sativus] Length = 535 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/45 (80%), Positives = 44/45 (97%) Frame = -3 Query: 264 RISYDEFSAMMKSGTDWRKASRQYSRVRYNNLSLSLMRDGSVKVK 130 RISYDEF+AMMK+GTDWRKASRQYSR R+N+LSL+LMRDGS+++K Sbjct: 490 RISYDEFAAMMKAGTDWRKASRQYSRERFNSLSLNLMRDGSLQLK 534 >ref|XP_002283549.2| PREDICTED: calcium-dependent protein kinase 32-like isoform 1 [Vitis vinifera] Length = 526 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -3 Query: 264 RISYDEFSAMMKSGTDWRKASRQYSRVRYNNLSLSLMRDGSVKVK 130 RISYDEF+AMMK+GTDWRKASRQYSR R+NNLSL L+RDGS++V+ Sbjct: 481 RISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIRDGSLEVR 525