BLASTX nr result
ID: Bupleurum21_contig00018005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018005 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC36700.1| protein phosphatase-2C [Mesembryanthemum crystall... 59 4e-07 ref|XP_002321985.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_002534559.1| protein phosphatase, putative [Ricinus commu... 57 2e-06 ref|XP_003526725.1| PREDICTED: protein phosphatase 2C 57-like [G... 54 1e-05 >gb|AAC36700.1| protein phosphatase-2C [Mesembryanthemum crystallinum] Length = 401 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -1 Query: 363 NWQSAPIQKQNIIFELGQAFATVGIVSFGIWMTSMLAL 250 NWQS P++KQN+++E+GQA ATV VS GIW++S+L L Sbjct: 364 NWQSLPVEKQNVLYEIGQALATVSFVSLGIWLSSLLML 401 >ref|XP_002321985.1| predicted protein [Populus trichocarpa] gi|222868981|gb|EEF06112.1| predicted protein [Populus trichocarpa] Length = 384 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = -1 Query: 363 NWQSAPIQKQNIIFELGQAFATVGIVSFGIWMTS 262 +WQ+ P+Q+QN++ ELGQAFAT+GIV+ GIWM+S Sbjct: 351 DWQNLPLQQQNVVLELGQAFATIGIVTLGIWMSS 384 >ref|XP_002534559.1| protein phosphatase, putative [Ricinus communis] gi|223525033|gb|EEF27824.1| protein phosphatase, putative [Ricinus communis] Length = 390 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = -1 Query: 363 NWQSAPIQKQNIIFELGQAFATVGIVSFGIWMTSMLAL 250 +W++ P+QKQNI+ E GQA AT+G+VS GIW++S L+L Sbjct: 353 DWRNLPLQKQNILLEFGQAIATIGVVSLGIWLSSQLSL 390 >ref|XP_003526725.1| PREDICTED: protein phosphatase 2C 57-like [Glycine max] Length = 388 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -1 Query: 363 NWQSAPIQKQNIIFELGQAFATVGIVSFGIWMTSMLAL 250 +WQ+AP+++QN I EL QA AT+GIVS GIW +S L+L Sbjct: 351 DWQNAPLERQNTILELVQALATIGIVSIGIWFSSQLSL 388