BLASTX nr result
ID: Bupleurum21_contig00017868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00017868 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305195.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-10 ref|XP_002531188.1| pentatricopeptide repeat-containing protein,... 67 1e-09 ref|XP_003633738.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 emb|CAN82481.1| hypothetical protein VITISV_012747 [Vitis vinifera] 63 3e-08 ref|XP_004171986.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_002305195.1| predicted protein [Populus trichocarpa] gi|222848159|gb|EEE85706.1| predicted protein [Populus trichocarpa] Length = 556 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/70 (45%), Positives = 46/70 (65%) Frame = +3 Query: 66 RLITSATAATEPEIVAAICGSLRRGLNWENLTKKYNNLELNKNTQIIEKILLELKQPHDA 245 R + T +V++IC SLRRG NW+ L +K+ +L+L N +++ +LLELK+P DA Sbjct: 33 RFLHDGTKTESDTVVSSICDSLRRGYNWDTLNRKFESLQL--NNLLVKNVLLELKEPTDA 90 Query: 246 NWALKFFHWS 275 AL FFHWS Sbjct: 91 KRALGFFHWS 100 >ref|XP_002531188.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529229|gb|EEF31203.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 619 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = +3 Query: 105 IVAAICGSLRRGLNWENLTKKYNNLELNKNTQIIEKILLELKQPHDANWALKFFHWS 275 IV AIC SLRRG NW +L+ K+ +ELN ++EK+LLELK+P DA AL FFHWS Sbjct: 46 IVYAICDSLRRGHNWVSLSGKFQYVELNH--LLVEKVLLELKEPIDAKRALGFFHWS 100 >ref|XP_003633738.1| PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Vitis vinifera] Length = 547 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = +3 Query: 108 VAAICGSLRRGLNWENLTKKYNNLELNKNTQIIEKILLELKQPHDANWALKFFHWS 275 V +C SLRRGLNW+ L +++ +LEL ++ + ++LLELK+P DA AL FFHWS Sbjct: 41 VNMLCDSLRRGLNWDALNQRFGSLELTES--FVGRVLLELKKPIDAKQALGFFHWS 94 >emb|CAN82481.1| hypothetical protein VITISV_012747 [Vitis vinifera] Length = 642 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = +3 Query: 108 VAAICGSLRRGLNWENLTKKYNNLELNKNTQIIEKILLELKQPHDANWALKFFHWS 275 V +C SLRRGLNW+ L +++ +LEL ++ + ++LLELK+P DA AL FFHWS Sbjct: 41 VNMLCDSLRRGLNWDALNQRFGSLELTES--FVGRVLLELKKPIDAKQALGFFHWS 94 >ref|XP_004171986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cucumis sativus] Length = 539 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/56 (48%), Positives = 39/56 (69%) Frame = +3 Query: 108 VAAICGSLRRGLNWENLTKKYNNLELNKNTQIIEKILLELKQPHDANWALKFFHWS 275 V +IC SL R +W+ L++K+ LELN +++K+LL+ +QP DA AL FFHWS Sbjct: 42 VNSICDSLTRRQSWDTLSRKFQFLELNDF--LVQKVLLKFQQPVDAKRALGFFHWS 95