BLASTX nr result
ID: Bupleurum21_contig00017474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00017474 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154853.1| PREDICTED: inositol-pentakisphosphate 2-kina... 49 5e-09 ref|XP_004147852.1| PREDICTED: inositol-pentakisphosphate 2-kina... 49 5e-09 >ref|XP_004154853.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis sativus] Length = 444 Score = 48.9 bits (115), Expect(2) = 5e-09 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = +2 Query: 251 PVSSDDIVVLKSTGQSFEYKASFLDLDRKPLKKMEYYYE 367 P S+ + + ++ST Q+F+YK +F+DLD KP KKME YYE Sbjct: 384 PGSTYNSIFVESTKQTFDYKVNFIDLDLKPFKKMEQYYE 422 Score = 36.2 bits (82), Expect(2) = 5e-09 Identities = 19/43 (44%), Positives = 30/43 (69%) Frame = +3 Query: 3 SQPCGVCRVFREVNENVLERYAHIHSYPRIKSLKIVKDYLISA 131 S+PC VCR + + +L+R A +HS +SL+IV++YLI+A Sbjct: 325 SEPCLVCRQMND--DELLKRCATLHSAHLDQSLEIVRNYLIAA 365 >ref|XP_004147852.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis sativus] Length = 444 Score = 48.9 bits (115), Expect(2) = 5e-09 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = +2 Query: 251 PVSSDDIVVLKSTGQSFEYKASFLDLDRKPLKKMEYYYE 367 P S+ + + ++ST Q+F+YK +F+DLD KP KKME YYE Sbjct: 384 PGSTYNSIFVESTKQTFDYKVNFIDLDLKPFKKMEQYYE 422 Score = 36.2 bits (82), Expect(2) = 5e-09 Identities = 19/43 (44%), Positives = 30/43 (69%) Frame = +3 Query: 3 SQPCGVCRVFREVNENVLERYAHIHSYPRIKSLKIVKDYLISA 131 S+PC VCR + + +L+R A +HS +SL+IV++YLI+A Sbjct: 325 SEPCLVCRQMND--DELLKRCATLHSAHLDQSLEIVRNYLIAA 365