BLASTX nr result
ID: Bupleurum21_contig00017393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00017393 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA32825.1| 179a [Daucus carota] 57 1e-06 >dbj|BAA32825.1| 179a [Daucus carota] Length = 311 Score = 57.4 bits (137), Expect = 1e-06 Identities = 40/94 (42%), Positives = 54/94 (57%), Gaps = 1/94 (1%) Frame = +2 Query: 35 SSAAMCMSTPRNSYISSPKSGLAVSLVNDMPAYPSNSDEDILALMNLFTEDTNMPPVENN 214 SSAA M P NS + S A ++ N D D+LA +++FTED NM PVE Sbjct: 2 SSAATHM-IPGNSNMWSTSGPSAPGPLDTGMPILLNPDSDVLASLDMFTEDINMLPVERK 60 Query: 215 ITQFERNGHLPCLDENNIYNDLADL-NWIELRDT 313 + + +G LP L EN+IY+ + DL +WIEL DT Sbjct: 61 -EKSDLSGQLPQLHENDIYDIIGDLDDWIELGDT 93