BLASTX nr result
ID: Bupleurum21_contig00017191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00017191 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30299.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002276674.1| PREDICTED: 1-(5-phosphoribosyl)-5-[(5-phosph... 62 6e-08 ref|XP_002528753.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 ref|XP_003537069.1| PREDICTED: LOW QUALITY PROTEIN: 1-(5-phospho... 59 4e-07 ref|XP_003593687.1| hypothetical protein MTR_2g015010 [Medicago ... 59 4e-07 >emb|CBI30299.3| unnamed protein product [Vitis vinifera] Length = 317 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 101 YVFNNGQMDLRRLEELVHLLGKEKLVLDLSCRK 3 YVFNNGQMDL RL++LVHL+GK++LVLDLSCRK Sbjct: 165 YVFNNGQMDLERLKDLVHLVGKQRLVLDLSCRK 197 >ref|XP_002276674.1| PREDICTED: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase, chloroplastic-like [Vitis vinifera] Length = 307 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 101 YVFNNGQMDLRRLEELVHLLGKEKLVLDLSCRK 3 YVFNNGQMDL RL++LVHL+GK++LVLDLSCRK Sbjct: 155 YVFNNGQMDLERLKDLVHLVGKQRLVLDLSCRK 187 >ref|XP_002528753.1| conserved hypothetical protein [Ricinus communis] gi|223531847|gb|EEF33665.1| conserved hypothetical protein [Ricinus communis] Length = 272 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -1 Query: 101 YVFNNGQMDLRRLEELVHLLGKEKLVLDLSCRK 3 YVFNNGQMDL RL++LVH++GK++LVLDLSCRK Sbjct: 157 YVFNNGQMDLERLKDLVHVVGKQRLVLDLSCRK 189 >ref|XP_003537069.1| PREDICTED: LOW QUALITY PROTEIN: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase, chloroplastic-like [Glycine max] Length = 214 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 101 YVFNNGQMDLRRLEELVHLLGKEKLVLDLSCRK 3 YVFNNGQMDL RL++LV ++GKE+LVLDLSCRK Sbjct: 55 YVFNNGQMDLERLKDLVQIVGKERLVLDLSCRK 87 >ref|XP_003593687.1| hypothetical protein MTR_2g015010 [Medicago truncatula] gi|355482735|gb|AES63938.1| hypothetical protein MTR_2g015010 [Medicago truncatula] Length = 312 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 101 YVFNNGQMDLRRLEELVHLLGKEKLVLDLSCRK 3 YVFNNGQMDL RL++LV ++GKE+LVLDLSCRK Sbjct: 160 YVFNNGQMDLERLKDLVRIVGKERLVLDLSCRK 192