BLASTX nr result
ID: Bupleurum21_contig00017089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00017089 (935 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513999.1| purine biosynthesis protein 7, pur7, putativ... 62 2e-07 ref|XP_002285714.1| PREDICTED: phosphoribosylaminoimidazole-succ... 59 2e-06 >ref|XP_002513999.1| purine biosynthesis protein 7, pur7, putative [Ricinus communis] gi|223547085|gb|EEF48582.1| purine biosynthesis protein 7, pur7, putative [Ricinus communis] Length = 324 Score = 62.0 bits (149), Expect = 2e-07 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = +1 Query: 253 KKPCLDS*SNIKRREEVMNDIKSIGLDNCLSETNLHLTVPALKSKTRGKVYILY 414 +K LDS N R++EV IK L NCLSETNLHLTVP LKSKTRGKV +Y Sbjct: 7 QKLSLDSLINSSRKDEVFGAIKG-SLSNCLSETNLHLTVPGLKSKTRGKVRDIY 59 >ref|XP_002285714.1| PREDICTED: phosphoribosylaminoimidazole-succinocarboxamide synthase, chloroplastic [Vitis vinifera] gi|302142022|emb|CBI19225.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 58.9 bits (141), Expect = 2e-06 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +1 Query: 265 LDS*SNIKRREEVMNDIKSIGLDNCLSETNLHLTVPALKSKTRGKVYILY 414 LD+ + R+EEV+ ++ L NCLSETNLHLTVPALKSKTRGKV +Y Sbjct: 49 LDALISSNRKEEVIGAVRH-SLSNCLSETNLHLTVPALKSKTRGKVRDVY 97