BLASTX nr result
ID: Bupleurum21_contig00016419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00016419 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311842.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002465565.1| hypothetical protein SORBIDRAFT_01g041205 [S... 56 3e-06 gb|AAL75989.1|AF466204_4 putative GAG-POL precursor -orf1 protei... 56 4e-06 ref|XP_002328882.1| predicted protein [Populus trichocarpa] gi|2... 56 4e-06 emb|CAC33017.1| hypothetical protein [Antirrhinum hispanicum] 56 4e-06 >ref|XP_002311842.1| predicted protein [Populus trichocarpa] gi|222851662|gb|EEE89209.1| predicted protein [Populus trichocarpa] Length = 324 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/72 (44%), Positives = 41/72 (56%) Frame = +1 Query: 1 LKLRIGTEPRTATHDQKFYVVDVDSPYNMILGRPMLTQFQAVCSLPHLKLKFPTEEGTGV 180 L + IGT P T Q F V+D PYN I+ RP+L Q V S +L +KFPT + V Sbjct: 171 LTITIGTAPHYVTLQQTFMVIDTHLPYNAIIRRPLLHQISVVVSTKYLTMKFPTVKVVVV 230 Query: 181 VQGNQVVARTLA 216 V+GNQ +R A Sbjct: 231 VKGNQEASRECA 242 >ref|XP_002465565.1| hypothetical protein SORBIDRAFT_01g041205 [Sorghum bicolor] gi|241919419|gb|EER92563.1| hypothetical protein SORBIDRAFT_01g041205 [Sorghum bicolor] Length = 1072 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/70 (44%), Positives = 38/70 (54%) Frame = +1 Query: 1 LKLRIGTEPRTATHDQKFYVVDVDSPYNMILGRPMLTQFQAVCSLPHLKLKFPTEEGTGV 180 L ++ GT T F V D D Y+ ILGRP LT+F AV +L LK PTE+G Sbjct: 930 LPVQFGTPDHFRTEFVNFVVADFDGTYHAILGRPSLTKFMAVPHYSYLVLKIPTEKGVLT 989 Query: 181 VQGNQVVART 210 V+GN A T Sbjct: 990 VRGNVYTAYT 999 >gb|AAL75989.1|AF466204_4 putative GAG-POL precursor -orf1 protein [Sorghum bicolor] Length = 841 Score = 55.8 bits (133), Expect = 4e-06 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 2/83 (2%) Frame = +1 Query: 1 LKLRIGTEPRTATHDQKFYVVDVDSPYNMILGRPMLTQFQAVCSLPHLKLKFPTEEGTGV 180 L ++ GT T F V D D Y+ ILGRP LT+F AV +L LK PTE+G Sbjct: 699 LPVQFGTPDHFWTEFVNFVVADFDGTYHAILGRPSLTKFMAVPHYSYLVLKMPTEKGVLT 758 Query: 181 VQGNQVVARTLALE--EVHESCD 243 V+GN A T E +V E+ D Sbjct: 759 VRGNVYTAYTCEEESFKVTEAID 781 >ref|XP_002328882.1| predicted protein [Populus trichocarpa] gi|222839312|gb|EEE77649.1| predicted protein [Populus trichocarpa] Length = 442 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/68 (42%), Positives = 39/68 (57%) Frame = +1 Query: 13 IGTEPRTATHDQKFYVVDVDSPYNMILGRPMLTQFQAVCSLPHLKLKFPTEEGTGVVQGN 192 IG E T + F V+ PYN I+GRP+L Q +A S +L LKFPT +G V+ N Sbjct: 321 IGIEGTTVPVKETFMVIITHHPYNAIIGRPLLHQLRAEVSTKYLTLKFPTSKGIVAVKRN 380 Query: 193 QVVARTLA 216 Q ++R A Sbjct: 381 QEISRECA 388 >emb|CAC33017.1| hypothetical protein [Antirrhinum hispanicum] Length = 1455 Score = 55.8 bits (133), Expect = 4e-06 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = +1 Query: 37 THDQKFYVVD-VDSPYNMILGRPMLTQFQAVCSLPHLKLKFPTEEGTGVVQGNQVVARTL 213 T + +F++++ + YN+I GRP L F+AV S+ HLK+KFP G G V+GNQ AR Sbjct: 563 TKEIRFWIINALAKTYNVICGRPSLCLFEAVPSVLHLKVKFPANNGIGEVKGNQARAREC 622 Query: 214 ALEEVHESCDKEDNIDDDPSRKRK 285 L + + D + +P R+ Sbjct: 623 RLNTMAAIEEGGDINEKNPCEPRR 646