BLASTX nr result
ID: Bupleurum21_contig00016396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00016396 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFO67240.1| putative cytochrome P450, partial [Aralia elata] 57 2e-06 >gb|AFO67240.1| putative cytochrome P450, partial [Aralia elata] Length = 151 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = +2 Query: 62 MTSTLHLHHFPPQQSVQHKINNNKRNPISNFTKLKGSFRYSGIKCSYTNGKLPSS 226 M +++ L HFP Q S Q +I+NN+ PI+ KL G+F YS I+CSY+NG+ P S Sbjct: 1 MAASVPLLHFPAQ-SFQTRIHNNQGKPIAKIIKLNGTFGYSAIRCSYSNGRKPDS 54