BLASTX nr result
ID: Bupleurum21_contig00016344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00016344 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK45282.1| unknown [Lotus japonicus] 64 1e-08 ref|XP_002268144.1| PREDICTED: uncharacterized protein At5g22580... 62 5e-08 gb|AFT91999.1| stress responsive A/B barrel domain family protei... 60 1e-07 gb|ACJ86123.1| unknown [Medicago truncatula] gi|388505032|gb|AFK... 60 1e-07 gb|AFT92000.1| stress responsive A/B barrel domain family protei... 60 2e-07 >gb|AFK45282.1| unknown [Lotus japonicus] Length = 107 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +1 Query: 1 KQDFTAFMSHPDHLQFSATFSAAIDKIVLLDFPTVLVKP 117 K+DF AF HP+H++FSATFS+AI+KIV+LDFP+ LVKP Sbjct: 65 KEDFAAFQGHPNHVEFSATFSSAIEKIVVLDFPSTLVKP 103 >ref|XP_002268144.1| PREDICTED: uncharacterized protein At5g22580 [Vitis vinifera] gi|147803505|emb|CAN68720.1| hypothetical protein VITISV_033679 [Vitis vinifera] Length = 105 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 7 DFTAFMSHPDHLQFSATFSAAIDKIVLLDFPTVLVK 114 DFTAF+SHP+H++FS TFSAAI+KIVLLDFP V VK Sbjct: 67 DFTAFLSHPNHVEFSTTFSAAIEKIVLLDFPAVPVK 102 >gb|AFT91999.1| stress responsive A/B barrel domain family protein [Populus tomentosa] gi|407260785|gb|AFT92011.1| stress responsive A/B barrel domain family protein [Populus tomentosa] Length = 110 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +1 Query: 1 KQDFTAFMSHPDHLQFSATFSAAIDKIVLLDFPTVLVKP 117 K+D+ AF SHP+H+++SATFSAAI+KIV+L FP+V VKP Sbjct: 70 KEDYAAFQSHPNHVEYSATFSAAIEKIVVLCFPSVCVKP 108 >gb|ACJ86123.1| unknown [Medicago truncatula] gi|388505032|gb|AFK40582.1| unknown [Medicago truncatula] Length = 111 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 1 KQDFTAFMSHPDHLQFSATFSAAIDKIVLLDFPTVLVKP 117 K+DF AF SHP H++FS FS AI+KIVLLDFP+ LVKP Sbjct: 68 KEDFAAFQSHPSHVEFSEKFSTAIEKIVLLDFPSNLVKP 106 >gb|AFT92000.1| stress responsive A/B barrel domain family protein [Populus alba x Populus tremula var. glandulosa] gi|407260787|gb|AFT92012.1| stress responsive A/B barrel domain family protein [Populus alba x Populus tremula var. glandulosa] Length = 110 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +1 Query: 1 KQDFTAFMSHPDHLQFSATFSAAIDKIVLLDFPTVLVKP 117 K+D+ AF SHP+H+++SATFSAAI+KIV+L FP V VKP Sbjct: 70 KEDYAAFQSHPNHVEYSATFSAAIEKIVVLCFPPVCVKP 108