BLASTX nr result
ID: Bupleurum21_contig00016322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00016322 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523799.1| Cell division protein ftsZ, putative [Ricinu... 59 3e-07 >ref|XP_002523799.1| Cell division protein ftsZ, putative [Ricinus communis] gi|223536887|gb|EEF38525.1| Cell division protein ftsZ, putative [Ricinus communis] Length = 491 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/48 (60%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = +2 Query: 206 CQKIVSSFPRFKCCSNSHRVTPN--KDSFLDLHPEVSMLGRERDDRFS 343 CQK SFP+ KC NSH V+PN KD+F DLHPEVSML + DD +S Sbjct: 48 CQKTGLSFPQIKCSINSHNVSPNNSKDTFSDLHPEVSMLRGKEDDLYS 95