BLASTX nr result
ID: Bupleurum21_contig00016270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00016270 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511939.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002511939.1| conserved hypothetical protein [Ricinus communis] gi|223549119|gb|EEF50608.1| conserved hypothetical protein [Ricinus communis] Length = 356 Score = 58.5 bits (140), Expect = 5e-07 Identities = 33/83 (39%), Positives = 50/83 (60%), Gaps = 2/83 (2%) Frame = -1 Query: 243 TASLHQRQLPSTLTDPYPLSPKST--TQKPGSILTRTNXXXXXXXXXXXXXXLPYTTTIP 70 T+ LHQR L ++L+DPYPLSP+++ +Q+ SI +RT +P+ T +P Sbjct: 2 TSFLHQRPLHNSLSDPYPLSPRNSANSQRQISIFSRTGLIVLFSLLLILGVFVPW-TELP 60 Query: 69 SPFFSSNSKIFESKWRQYTLSQA 1 + FS+ + +KWRQYTL QA Sbjct: 61 NGIFSATKQSSVAKWRQYTLPQA 83