BLASTX nr result
ID: Bupleurum21_contig00016155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00016155 (752 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316699.1| predicted protein [Populus trichocarpa] gi|2... 59 1e-06 emb|CAN76854.1| hypothetical protein VITISV_006002 [Vitis vinifera] 57 3e-06 >ref|XP_002316699.1| predicted protein [Populus trichocarpa] gi|222859764|gb|EEE97311.1| predicted protein [Populus trichocarpa] Length = 354 Score = 58.5 bits (140), Expect = 1e-06 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 6/100 (6%) Frame = -3 Query: 282 QTQHGYGSDGVNYCESIFGYWPCLAKKNKKTDEYIQENCDTINGSDLPKETDLCKETAEY 103 Q GYG + ++ CES+FGYWPCL++ Y + D +D + K TA+Y Sbjct: 255 QIPPGYGLEAMDLCESLFGYWPCLSR-------YARNVNDCQEAADCGSRGNQWKGTADY 307 Query: 102 IFGSSLVCEE------ASGTQGHGHESHYRQPPCYGQEIY 1 +FGSS E + G +G+E HY++ P Q Y Sbjct: 308 LFGSSNPYGERDDGGNSHGNAIYGYERHYQEEPLSYQVKY 347 >emb|CAN76854.1| hypothetical protein VITISV_006002 [Vitis vinifera] Length = 359 Score = 57.4 bits (137), Expect = 3e-06 Identities = 32/103 (31%), Positives = 56/103 (54%), Gaps = 6/103 (5%) Frame = -3 Query: 300 DEQIVAQTQHGYGSDGVNYCESIFGYWPCLAKKNKKTDEYIQENCDTINGSDLPKETDLC 121 +E+ V Q GY + +++CESIFG+WPCL K+ + + ++ + ++ Sbjct: 251 NEKQVPQDPWGYSPEAMDFCESIFGHWPCLYKQKRHGHQ---------GTTNEERNSNQW 301 Query: 120 KETAEYIFGSSLVC---EEASGTQG---HGHESHYRQPPCYGQ 10 K T ++IFGSS ++ G+ G +G+E HY++ P Y Q Sbjct: 302 KGTEDFIFGSSYPYTHQKDEGGSHGDAIYGYERHYQEQPHYPQ 344