BLASTX nr result
ID: Bupleurum21_contig00016057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00016057 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJW04186.1| hypothetical protein EDEG_01518 [Edhazardia aedis... 56 3e-06 >gb|EJW04186.1| hypothetical protein EDEG_01518 [Edhazardia aedis USNM 41457] Length = 586 Score = 55.8 bits (133), Expect = 3e-06 Identities = 42/102 (41%), Positives = 53/102 (51%), Gaps = 2/102 (1%) Frame = -1 Query: 315 HPIANPISNPYHFPSTPNFSHNPNFIHPVANPISIPNYVPNFGHNPNFVQPVTDPNRPFV 136 +P NP +NP + + PN + NPN +P NP + PN PN +NPN T+PN P Sbjct: 195 NPNTNPNTNP-NIQNNPNTNPNPN-TNPNTNPNTNPNTNPNIQNNPN-----TNPN-PNP 246 Query: 135 NPGHAPSFNAN-HDFISPVTNP-IFPILNPNHIPNGPIMGPN 16 NP P+ N N + P TNP P NPN I N P PN Sbjct: 247 NPNTNPNTNPNTNPNTDPNTNPNTDPFTNPN-IQNNPNTNPN 287