BLASTX nr result
ID: Bupleurum21_contig00015488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00015488 (670 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513609.1| conserved hypothetical protein [Ricinus comm... 134 2e-29 ref|XP_002315392.1| predicted protein [Populus trichocarpa] gi|2... 133 4e-29 ref|XP_004142440.1| PREDICTED: cytochrome c oxidase assembly fac... 131 1e-28 ref|XP_003578454.1| PREDICTED: cytochrome c oxidase assembly fac... 130 2e-28 ref|XP_002460536.1| hypothetical protein SORBIDRAFT_02g030100 [S... 130 2e-28 >ref|XP_002513609.1| conserved hypothetical protein [Ricinus communis] gi|223547517|gb|EEF49012.1| conserved hypothetical protein [Ricinus communis] Length = 71 Score = 134 bits (337), Expect = 2e-29 Identities = 63/71 (88%), Positives = 65/71 (91%) Frame = +1 Query: 46 MAKSCKGLAAELVKCLSESDCVTVENRPYRECAKEQSPSISSECVGLRETYFNCKRGQID 225 MAKSCKGLA ELVKCLSESDCV VE RPYRECA E+SP I SECVGLRETYFNCKRGQ+D Sbjct: 1 MAKSCKGLAMELVKCLSESDCVKVEKRPYRECAGEKSPCIPSECVGLRETYFNCKRGQLD 60 Query: 226 MRARIRGNKGY 258 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_002315392.1| predicted protein [Populus trichocarpa] gi|222864432|gb|EEF01563.1| predicted protein [Populus trichocarpa] Length = 71 Score = 133 bits (334), Expect = 4e-29 Identities = 60/71 (84%), Positives = 67/71 (94%) Frame = +1 Query: 46 MAKSCKGLAAELVKCLSESDCVTVENRPYRECAKEQSPSISSECVGLRETYFNCKRGQID 225 M+KSCKGLA ELVKCLSESDC+ +E+RPY+ECA E+SPSI SECVGLRETYFNCKRGQ+D Sbjct: 1 MSKSCKGLALELVKCLSESDCIKMEDRPYKECAGEKSPSIPSECVGLRETYFNCKRGQVD 60 Query: 226 MRARIRGNKGY 258 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_004142440.1| PREDICTED: cytochrome c oxidase assembly factor 5-like [Cucumis sativus] gi|449487146|ref|XP_004157510.1| PREDICTED: cytochrome c oxidase assembly factor 5-like [Cucumis sativus] Length = 71 Score = 131 bits (330), Expect = 1e-28 Identities = 61/71 (85%), Positives = 65/71 (91%) Frame = +1 Query: 46 MAKSCKGLAAELVKCLSESDCVTVENRPYRECAKEQSPSISSECVGLRETYFNCKRGQID 225 M+KSCKGLA ELVKCLSESDCV V+NR YRECA E+SP I SECVGLRETYFNCKRGQ+D Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVQNRTYRECAGEKSPCIPSECVGLRETYFNCKRGQVD 60 Query: 226 MRARIRGNKGY 258 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_003578454.1| PREDICTED: cytochrome c oxidase assembly factor 5-like [Brachypodium distachyon] gi|326497105|dbj|BAK02137.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 71 Score = 130 bits (327), Expect = 2e-28 Identities = 58/71 (81%), Positives = 67/71 (94%) Frame = +1 Query: 46 MAKSCKGLAAELVKCLSESDCVTVENRPYRECAKEQSPSISSECVGLRETYFNCKRGQID 225 M+KSCKGLA ELVKCLSE+DCV V+ RPY+ECA E++P+I+SECVGLRETYFNCKRGQ+D Sbjct: 1 MSKSCKGLAMELVKCLSETDCVKVQKRPYKECAGEKAPNITSECVGLRETYFNCKRGQVD 60 Query: 226 MRARIRGNKGY 258 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_002460536.1| hypothetical protein SORBIDRAFT_02g030100 [Sorghum bicolor] gi|241923913|gb|EER97057.1| hypothetical protein SORBIDRAFT_02g030100 [Sorghum bicolor] gi|414589991|tpg|DAA40562.1| TPA: hypothetical protein ZEAMMB73_292465 [Zea mays] Length = 71 Score = 130 bits (327), Expect = 2e-28 Identities = 59/71 (83%), Positives = 66/71 (92%) Frame = +1 Query: 46 MAKSCKGLAAELVKCLSESDCVTVENRPYRECAKEQSPSISSECVGLRETYFNCKRGQID 225 MAKSCKGLA ELVKCLSE+DCV V+ RPY+ECA E+ P+I+SECVGLRETYFNCKRGQ+D Sbjct: 1 MAKSCKGLAMELVKCLSETDCVKVQKRPYKECAGEKVPNITSECVGLRETYFNCKRGQVD 60 Query: 226 MRARIRGNKGY 258 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71