BLASTX nr result
ID: Bupleurum21_contig00015056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00015056 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518871.1| conserved hypothetical protein [Ricinus comm... 40 2e-07 >ref|XP_002518871.1| conserved hypothetical protein [Ricinus communis] gi|223541858|gb|EEF43404.1| conserved hypothetical protein [Ricinus communis] Length = 668 Score = 40.4 bits (93), Expect(2) = 2e-07 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 216 DICVLVGMISWCLWNRRNKWFWDKLNGSAFGVRAAAMNFLADWKEAQ 356 D C + ++ LWN+RN W W+K + + +GV + A L AQ Sbjct: 522 DTCAKMALVCGSLWNQRNHWVWNKQSNTTYGVISPANQLLEQRTRAQ 568 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = +2 Query: 8 TAYALAVKHIAESARCPWCRSEVETDTHVLFTCDFARTVWYSAGLQ 145 TA L ++++ C WC E ET HVLF C AR W G + Sbjct: 454 TAMNLRMRYVDLDPLCKWCNREPETLFHVLFGCSMARECWDLLGFR 499