BLASTX nr result
ID: Bupleurum21_contig00014908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00014908 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34360.3| unnamed protein product [Vitis vinifera] 92 6e-17 ref|XP_002280000.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 92 6e-17 ref|XP_002509832.1| protein binding protein, putative [Ricinus c... 92 6e-17 ref|NP_001241561.1| uncharacterized protein LOC100816369 [Glycin... 91 7e-17 ref|XP_003528846.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 91 1e-16 >emb|CBI34360.3| unnamed protein product [Vitis vinifera] Length = 227 Score = 91.7 bits (226), Expect = 6e-17 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 1 YDAENPKIITKCEHHFHLACILEWLERSDTCPVCDQEMIFD 123 YDAENPKI+TKCEHHFHLACILEW+ERSDTCPVCD+EMIF+ Sbjct: 182 YDAENPKIVTKCEHHFHLACILEWMERSDTCPVCDKEMIFN 222 >ref|XP_002280000.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Vitis vinifera] Length = 213 Score = 91.7 bits (226), Expect = 6e-17 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 1 YDAENPKIITKCEHHFHLACILEWLERSDTCPVCDQEMIFD 123 YDAENPKI+TKCEHHFHLACILEW+ERSDTCPVCD+EMIF+ Sbjct: 168 YDAENPKIVTKCEHHFHLACILEWMERSDTCPVCDKEMIFN 208 >ref|XP_002509832.1| protein binding protein, putative [Ricinus communis] gi|223549731|gb|EEF51219.1| protein binding protein, putative [Ricinus communis] Length = 212 Score = 91.7 bits (226), Expect = 6e-17 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +1 Query: 1 YDAENPKIITKCEHHFHLACILEWLERSDTCPVCDQEMIFDPTI 132 YDAENPKI TKCEHHFHL+CILEW+ERSDTCPVCD+EMI DP + Sbjct: 168 YDAENPKITTKCEHHFHLSCILEWMERSDTCPVCDKEMIIDPPL 211 >ref|NP_001241561.1| uncharacterized protein LOC100816369 [Glycine max] gi|255641755|gb|ACU21148.1| unknown [Glycine max] Length = 213 Score = 91.3 bits (225), Expect = 7e-17 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +1 Query: 1 YDAENPKIITKCEHHFHLACILEWLERSDTCPVCDQEMIFDPTI 132 YDAENPK+ TKC+HHFHLACILEW+ERS+TCPVCDQ+++FDP I Sbjct: 169 YDAENPKLATKCDHHFHLACILEWMERSETCPVCDQDLVFDPPI 212 >ref|XP_003528846.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Glycine max] Length = 191 Score = 90.5 bits (223), Expect = 1e-16 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +1 Query: 1 YDAENPKIITKCEHHFHLACILEWLERSDTCPVCDQEMIFDPTI 132 YD ENPK +TKCEHHFHL+CILEW+ERSD+CP+CDQEMIFD T+ Sbjct: 147 YDVENPKTLTKCEHHFHLSCILEWMERSDSCPICDQEMIFDQTL 190