BLASTX nr result
ID: Bupleurum21_contig00014897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00014897 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631305.1| PREDICTED: LOW QUALITY PROTEIN: transcriptio... 61 1e-07 emb|CBI27416.3| unnamed protein product [Vitis vinifera] 61 1e-07 >ref|XP_003631305.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH49-like [Vitis vinifera] Length = 609 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = -3 Query: 478 RTISSHMTAMRGGNKDLTSQPPVPDTWEDELHNIVHTGLNPNAPLNIEDLNDKTFP 311 RTI+S + AM GG K+ S P +P+ WEDELHN+V G + APLN +DLN P Sbjct: 549 RTINSQLAAMSGGYKE--SAPQLPNVWEDELHNVVQMGFSTGAPLNSQDLNGSLPP 602 >emb|CBI27416.3| unnamed protein product [Vitis vinifera] Length = 496 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = -3 Query: 478 RTISSHMTAMRGGNKDLTSQPPVPDTWEDELHNIVHTGLNPNAPLNIEDLNDKTFP 311 RTI+S + AM GG K+ S P +P+ WEDELHN+V G + APLN +DLN P Sbjct: 436 RTINSQLAAMSGGYKE--SAPQLPNVWEDELHNVVQMGFSTGAPLNSQDLNGSLPP 489