BLASTX nr result
ID: Bupleurum21_contig00014812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00014812 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515673.1| oligopeptide transporter, putative [Ricinus ... 72 5e-11 ref|XP_002864249.1| predicted protein [Arabidopsis lyrata subsp.... 71 8e-11 emb|CBI23058.3| unnamed protein product [Vitis vinifera] 71 8e-11 ref|XP_002274166.1| PREDICTED: metal-nicotianamine transporter Y... 71 8e-11 emb|CAN77891.1| hypothetical protein VITISV_016271 [Vitis vinifera] 71 8e-11 >ref|XP_002515673.1| oligopeptide transporter, putative [Ricinus communis] gi|223545216|gb|EEF46725.1| oligopeptide transporter, putative [Ricinus communis] Length = 671 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 3 AVASGLICGDGLWILPSSILALARINPPICMNFLPTQ 113 AVASGLICGDGLWILPSSILALA+I+PPICMNFL T+ Sbjct: 635 AVASGLICGDGLWILPSSILALAKIHPPICMNFLATK 671 >ref|XP_002864249.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297310084|gb|EFH40508.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 675 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +3 Query: 3 AVASGLICGDGLWILPSSILALARINPPICMNFLPTQLS 119 AVASGLICGDGLWILPSS+LALA + PPICMNF+P++ S Sbjct: 636 AVASGLICGDGLWILPSSVLALAGVKPPICMNFMPSKYS 674 >emb|CBI23058.3| unnamed protein product [Vitis vinifera] Length = 649 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 3 AVASGLICGDGLWILPSSILALARINPPICMNFLPT 110 AVASGLICGDGLWILPSS+LALA+INPPICM+FL T Sbjct: 614 AVASGLICGDGLWILPSSVLALAKINPPICMSFLAT 649 >ref|XP_002274166.1| PREDICTED: metal-nicotianamine transporter YSL3-like [Vitis vinifera] Length = 665 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 3 AVASGLICGDGLWILPSSILALARINPPICMNFLPT 110 AVASGLICGDGLWILPSS+LALA+INPPICM+FL T Sbjct: 630 AVASGLICGDGLWILPSSVLALAKINPPICMSFLAT 665 >emb|CAN77891.1| hypothetical protein VITISV_016271 [Vitis vinifera] Length = 677 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 3 AVASGLICGDGLWILPSSILALARINPPICMNFLPT 110 AVASGLICGDGLWILPSS+LALA+INPPICM+FL T Sbjct: 642 AVASGLICGDGLWILPSSVLALAKINPPICMSFLAT 677