BLASTX nr result
ID: Bupleurum21_contig00014806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00014806 (698 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327852.1| predicted protein [Populus trichocarpa] gi|2... 96 9e-18 ref|XP_002513565.1| kinase, putative [Ricinus communis] gi|22354... 93 6e-17 ref|XP_002514776.1| receptor serine/threonine kinase, putative [... 92 1e-16 ref|XP_002309736.1| predicted protein [Populus trichocarpa] gi|2... 92 1e-16 ref|XP_002321441.1| predicted protein [Populus trichocarpa] gi|2... 91 2e-16 >ref|XP_002327852.1| predicted protein [Populus trichocarpa] gi|222837261|gb|EEE75640.1| predicted protein [Populus trichocarpa] Length = 349 Score = 95.5 bits (236), Expect = 9e-18 Identities = 43/56 (76%), Positives = 51/56 (91%) Frame = +2 Query: 530 FLQAQNNLMPIRYAYSDIKKITNNFKHKLGEGGFGTVYKGKLRSGLFVAVKMLGKS 697 FLQ+QNNLMP+RY+YSDI+KIT FK +LG+GGFGTVYKGKLRSG F A+K+LGKS Sbjct: 31 FLQSQNNLMPVRYSYSDIRKITRGFKDELGKGGFGTVYKGKLRSGRFAAIKLLGKS 86 >ref|XP_002513565.1| kinase, putative [Ricinus communis] gi|223547473|gb|EEF48968.1| kinase, putative [Ricinus communis] Length = 662 Score = 92.8 bits (229), Expect = 6e-17 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +2 Query: 530 FLQAQNNLMPIRYAYSDIKKITNNFKHKLGEGGFGTVYKGKLRSGLFVAVKMLGKS 697 FL++QNN MPIRY+Y DI+K+TNNFK KLGEGG+G+VYKGKLRSG AVK+LGKS Sbjct: 312 FLESQNNFMPIRYSYLDIRKMTNNFKDKLGEGGYGSVYKGKLRSGCLAAVKILGKS 367 >ref|XP_002514776.1| receptor serine/threonine kinase, putative [Ricinus communis] gi|223545827|gb|EEF47330.1| receptor serine/threonine kinase, putative [Ricinus communis] Length = 656 Score = 92.0 bits (227), Expect = 1e-16 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +2 Query: 530 FLQAQNNLMPIRYAYSDIKKITNNFKHKLGEGGFGTVYKGKLRSGLFVAVKMLGKS 697 FLQ+ NLMP+RY+YSD+KKIT NFK+KLGEGG+G VY+GKLRSG VAVK+LGKS Sbjct: 315 FLQSHANLMPVRYSYSDLKKITTNFKYKLGEGGYGCVYRGKLRSGRLVAVKILGKS 370 >ref|XP_002309736.1| predicted protein [Populus trichocarpa] gi|222852639|gb|EEE90186.1| predicted protein [Populus trichocarpa] Length = 347 Score = 91.7 bits (226), Expect = 1e-16 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +2 Query: 530 FLQAQNNLMPIRYAYSDIKKITNNFKHKLGEGGFGTVYKGKLRSGLFVAVKMLGKS 697 FLQ+ +NLMP+RY+YS+IKKITN+FK KLGEGGFG+VYKGKLRSG F AVK+L S Sbjct: 8 FLQSNDNLMPVRYSYSEIKKITNDFKEKLGEGGFGSVYKGKLRSGRFAAVKILSNS 63 >ref|XP_002321441.1| predicted protein [Populus trichocarpa] gi|222868437|gb|EEF05568.1| predicted protein [Populus trichocarpa] Length = 219 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = +2 Query: 530 FLQAQNNLMPIRYAYSDIKKITNNFKHKLGEGGFGTVYKGKLRSGLFVAVKMLGKS 697 FLQ+QNN PIRY+YSDIKKITN FK KLG+GG+G+VYKGKLRSG AVKML KS Sbjct: 8 FLQSQNNFAPIRYSYSDIKKITNGFKEKLGQGGYGSVYKGKLRSGHLAAVKMLDKS 63