BLASTX nr result
ID: Bupleurum21_contig00014751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00014751 (372 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869876.1| hypothetical protein ARALYDRAFT_914508 [Arab... 73 3e-11 ref|NP_001190788.1| glycine-rich protein [Arabidopsis thaliana] ... 70 1e-10 ref|NP_193893.1| glycine-rich protein [Arabidopsis thaliana] gi|... 70 1e-10 ref|XP_002521418.1| nucleic acid binding protein, putative [Rici... 68 7e-10 ref|XP_003608189.1| hypothetical protein MTR_4g090520 [Medicago ... 68 9e-10 >ref|XP_002869876.1| hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] gi|297315712|gb|EFH46135.1| hypothetical protein ARALYDRAFT_914508 [Arabidopsis lyrata subsp. lyrata] Length = 131 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/57 (56%), Positives = 33/57 (57%) Frame = +1 Query: 70 VVRPVVTCKVKGPCYGKKLRCPAKCFTXXXXXXXXXXXXXXXXXCNMDCKNKCTASC 240 VVRP VTC+ KGPCYGKKLRCPAKCF C MDCK KC A C Sbjct: 75 VVRPTVTCREKGPCYGKKLRCPAKCFKSFSRSGKGYGGGGGGGGCTMDCKKKCIAYC 131 >ref|NP_001190788.1| glycine-rich protein [Arabidopsis thaliana] gi|332659082|gb|AEE84482.1| glycine-rich protein [Arabidopsis thaliana] Length = 98 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/57 (56%), Positives = 32/57 (56%) Frame = +1 Query: 70 VVRPVVTCKVKGPCYGKKLRCPAKCFTXXXXXXXXXXXXXXXXXCNMDCKNKCTASC 240 VVRP VTCK KGPC GKKLRCPAKCF C MDCK KC A C Sbjct: 42 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRSGKGYGGGGGGGGCTMDCKKKCIAYC 98 >ref|NP_193893.1| glycine-rich protein [Arabidopsis thaliana] gi|13507541|gb|AAK28633.1|AF360336_1 unknown protein [Arabidopsis thaliana] gi|4455270|emb|CAB36806.1| putative protein [Arabidopsis thaliana] gi|7268959|emb|CAB81269.1| putative protein [Arabidopsis thaliana] gi|15293275|gb|AAK93748.1| unknown protein [Arabidopsis thaliana] gi|16648720|gb|AAL25552.1| AT4g21620/F17L22_80 [Arabidopsis thaliana] gi|21553868|gb|AAM62961.1| unknown [Arabidopsis thaliana] gi|110742179|dbj|BAE99017.1| hypothetical protein [Arabidopsis thaliana] gi|332659081|gb|AEE84481.1| glycine-rich protein [Arabidopsis thaliana] Length = 131 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/57 (56%), Positives = 32/57 (56%) Frame = +1 Query: 70 VVRPVVTCKVKGPCYGKKLRCPAKCFTXXXXXXXXXXXXXXXXXCNMDCKNKCTASC 240 VVRP VTCK KGPC GKKLRCPAKCF C MDCK KC A C Sbjct: 75 VVRPTVTCKEKGPCNGKKLRCPAKCFKSFSRSGKGYGGGGGGGGCTMDCKKKCIAYC 131 >ref|XP_002521418.1| nucleic acid binding protein, putative [Ricinus communis] gi|223539317|gb|EEF40908.1| nucleic acid binding protein, putative [Ricinus communis] Length = 147 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/57 (50%), Positives = 31/57 (54%) Frame = +1 Query: 70 VVRPVVTCKVKGPCYGKKLRCPAKCFTXXXXXXXXXXXXXXXXXCNMDCKNKCTASC 240 ++RP V CK KGPCY KKL CPAKCFT C MDCK KC A C Sbjct: 91 IIRPTVVCKEKGPCYKKKLTCPAKCFTSYSRSGKGYGGGGGGGGCTMDCKKKCIAYC 147 >ref|XP_003608189.1| hypothetical protein MTR_4g090520 [Medicago truncatula] gi|355509244|gb|AES90386.1| hypothetical protein MTR_4g090520 [Medicago truncatula] Length = 138 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/57 (49%), Positives = 33/57 (57%) Frame = +1 Query: 70 VVRPVVTCKVKGPCYGKKLRCPAKCFTXXXXXXXXXXXXXXXXXCNMDCKNKCTASC 240 V+RP V CK +GPCY KK+ CPA+CFT C +DCK KCTASC Sbjct: 82 VIRPTVVCKDRGPCYQKKVTCPARCFTSFSRSGKGYGGGGGGGGCTIDCKKKCTASC 138