BLASTX nr result
ID: Bupleurum21_contig00014715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00014715 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530347.1| sorting nexin 3, putative [Ricinus communis]... 67 2e-09 ref|XP_002322816.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 gb|AFK41602.1| unknown [Medicago truncatula] 65 4e-09 ref|NP_001239848.1| uncharacterized protein LOC100804649 [Glycin... 65 4e-09 ref|XP_003518207.1| PREDICTED: sorting nexin-2-like [Glycine max] 65 6e-09 >ref|XP_002530347.1| sorting nexin 3, putative [Ricinus communis] gi|223530151|gb|EEF32063.1| sorting nexin 3, putative [Ricinus communis] Length = 399 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 409 AFHEFAKGQARLANSIADAWRSLLPKLEACSA 314 AFHEFAKGQARLANSIADAWRSLLPKLEACS+ Sbjct: 368 AFHEFAKGQARLANSIADAWRSLLPKLEACSS 399 >ref|XP_002322816.1| predicted protein [Populus trichocarpa] gi|222867446|gb|EEF04577.1| predicted protein [Populus trichocarpa] Length = 392 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 409 AFHEFAKGQARLANSIADAWRSLLPKLEACSA 314 AFHEFAKGQARLANSIADAWRSLLPKLEACS+ Sbjct: 361 AFHEFAKGQARLANSIADAWRSLLPKLEACSS 392 >gb|AFK41602.1| unknown [Medicago truncatula] Length = 260 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 409 AFHEFAKGQARLANSIADAWRSLLPKLEACSAA 311 AFHEFAKGQARLAN IADAWRSLLPKLEACS++ Sbjct: 228 AFHEFAKGQARLANGIADAWRSLLPKLEACSSS 260 >ref|NP_001239848.1| uncharacterized protein LOC100804649 [Glycine max] gi|255640209|gb|ACU20395.1| unknown [Glycine max] Length = 405 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 409 AFHEFAKGQARLANSIADAWRSLLPKLEACSAA 311 AFHEFAKGQARLAN IADAWRSLLPKLEACS++ Sbjct: 373 AFHEFAKGQARLANGIADAWRSLLPKLEACSSS 405 >ref|XP_003518207.1| PREDICTED: sorting nexin-2-like [Glycine max] Length = 405 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 409 AFHEFAKGQARLANSIADAWRSLLPKLEACSAA 311 AFHEFAKGQARLAN IADAWRSLLPKLEACS + Sbjct: 373 AFHEFAKGQARLANGIADAWRSLLPKLEACSTS 405