BLASTX nr result
ID: Bupleurum21_contig00013961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00013961 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP94586.1| putative retrotransposon RIRE1 poly protein [Zea ... 56 3e-06 >gb|AAP94586.1| putative retrotransposon RIRE1 poly protein [Zea mays] Length = 1309 Score = 55.8 bits (133), Expect = 3e-06 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 6/82 (7%) Frame = -1 Query: 242 PEKYNGGIGFSRWQKKMKMWLT-VKGLWLVVQYDPPVV-----DQAKPETMVTYTKWAEK 81 PE ++G F RWQ K +MWLT +K W+V P D AK + KW E Sbjct: 27 PEAFDGA-SFKRWQIKTRMWLTDLKLFWVVTSAVPQAASDDSDDAAKAAALAEKAKWDEA 85 Query: 80 DGAAKAAILTALSNALFDVYAS 15 + A + +L LSN LFDVY++ Sbjct: 86 NEACLSRLLNVLSNRLFDVYSA 107