BLASTX nr result
ID: Bupleurum21_contig00013845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00013845 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610724.1| Cysteine synthase [Medicago truncatula] gi|3... 60 2e-07 ref|XP_003610723.1| Cysteine synthase [Medicago truncatula] gi|2... 60 2e-07 ref|XP_002517133.1| cysteine synthase, putative [Ricinus communi... 59 3e-07 ref|NP_001235628.1| cysteine synthase [Glycine max] gi|18252506|... 59 4e-07 gb|ABQ02253.1| O-acetylserine (thiol)lyase [Glycine soja] 59 4e-07 >ref|XP_003610724.1| Cysteine synthase [Medicago truncatula] gi|355512059|gb|AES93682.1| Cysteine synthase [Medicago truncatula] Length = 284 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 VIFPSFGERYLSSVLFESVRREAEAMTFEP 91 V+FPSFGERYLSSVLFESVRREAE MTFEP Sbjct: 255 VVFPSFGERYLSSVLFESVRREAETMTFEP 284 >ref|XP_003610723.1| Cysteine synthase [Medicago truncatula] gi|217074042|gb|ACJ85381.1| unknown [Medicago truncatula] gi|355512058|gb|AES93681.1| Cysteine synthase [Medicago truncatula] Length = 325 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 VIFPSFGERYLSSVLFESVRREAEAMTFEP 91 V+FPSFGERYLSSVLFESVRREAE MTFEP Sbjct: 296 VVFPSFGERYLSSVLFESVRREAETMTFEP 325 >ref|XP_002517133.1| cysteine synthase, putative [Ricinus communis] gi|223543768|gb|EEF45296.1| cysteine synthase, putative [Ricinus communis] Length = 325 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 2 VIFPSFGERYLSSVLFESVRREAEAMTFEP 91 V+FPSFGERYLSSVLFESVRREAE+MT+EP Sbjct: 296 VVFPSFGERYLSSVLFESVRREAESMTYEP 325 >ref|NP_001235628.1| cysteine synthase [Glycine max] gi|18252506|gb|AAL66291.1|AF452451_1 cysteine synthase [Glycine max] Length = 325 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 5 IFPSFGERYLSSVLFESVRREAEAMTFEP 91 +FPSFGERYLSSVLFESVRREAE+MTFEP Sbjct: 297 VFPSFGERYLSSVLFESVRREAESMTFEP 325 >gb|ABQ02253.1| O-acetylserine (thiol)lyase [Glycine soja] Length = 325 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 5 IFPSFGERYLSSVLFESVRREAEAMTFEP 91 +FPSFGERYLSSVLFESVRREAE+MTFEP Sbjct: 297 VFPSFGERYLSSVLFESVRREAESMTFEP 325