BLASTX nr result
ID: Bupleurum21_contig00013775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00013775 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA71770.1| bZIP DNA-binding protein [Petroselinum crispum] 90 2e-16 emb|CAA71768.1| bZIP DNA-binding protein [Petroselinum crispum] 84 2e-14 gb|AAD42938.1|AF084972_1 G-Box binding protein 2 [Catharanthus r... 73 3e-11 ref|XP_004146103.1| PREDICTED: transcription factor HBP-1a-like ... 70 1e-10 gb|AAK39130.1|AF369790_1 bZIP transcription factor 2 [Phaseolus ... 70 1e-10 >emb|CAA71770.1| bZIP DNA-binding protein [Petroselinum crispum] Length = 420 Score = 89.7 bits (221), Expect = 2e-16 Identities = 45/64 (70%), Positives = 46/64 (71%), Gaps = 11/64 (17%) Frame = +2 Query: 197 MGSSDMEKSPKDAKEAKEPKNSTSQEQASPAVG-----------GPVTPDWSGFQAYSPM 343 MGSS M+KSPKD KEAKEPK TSQEQ SPA GPVTPDWSGFQAYSPM Sbjct: 1 MGSSGMDKSPKDIKEAKEPKIPTSQEQPSPAAAAAAAAAAAAAAGPVTPDWSGFQAYSPM 60 Query: 344 PPHG 355 PPHG Sbjct: 61 PPHG 64 >emb|CAA71768.1| bZIP DNA-binding protein [Petroselinum crispum] Length = 407 Score = 83.6 bits (205), Expect = 2e-14 Identities = 42/56 (75%), Positives = 44/56 (78%), Gaps = 3/56 (5%) Frame = +2 Query: 197 MGSSDMEKSPKDAKEAKEPKNSTSQEQASPAVGGP---VTPDWSGFQAYSPMPPHG 355 MGSS+MEKS +KE KEPK TSQEQ SP V GP VTPDWSGFQAYSPMPPHG Sbjct: 1 MGSSEMEKS---SKETKEPKTPTSQEQVSPVVAGPAGPVTPDWSGFQAYSPMPPHG 53 >gb|AAD42938.1|AF084972_1 G-Box binding protein 2 [Catharanthus roseus] Length = 394 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +2 Query: 197 MGSSDMEKSPKDAKEAKEPKNSTSQEQASPAVGGPVTPDWSGFQAYSPMPPHG 355 MGSS+++KS K+AKEAKE K + Q PA TPDW+GFQAYSP+PPHG Sbjct: 1 MGSSEIDKSSKEAKEAKEAKETPPSSQEQPAATSAGTPDWTGFQAYSPIPPHG 53 >ref|XP_004146103.1| PREDICTED: transcription factor HBP-1a-like [Cucumis sativus] Length = 405 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/53 (60%), Positives = 38/53 (71%) Frame = +2 Query: 197 MGSSDMEKSPKDAKEAKEPKNSTSQEQASPAVGGPVTPDWSGFQAYSPMPPHG 355 M S+MEK PKD +E K P +T+QEQ + G V PDWSGFQAYSP+PPHG Sbjct: 1 MSGSEMEKPPKD-RETKTPPPTTTQEQTTTTSAGTVNPDWSGFQAYSPIPPHG 52 >gb|AAK39130.1|AF369790_1 bZIP transcription factor 2 [Phaseolus vulgaris] Length = 417 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/54 (64%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = +2 Query: 197 MGSSDMEKSPKDAKEAKEPKNSTSQEQASPAVG-GPVTPDWSGFQAYSPMPPHG 355 MGSSDM+K+PK+ KE+K P +TSQEQ+ P G + PDWS FQAYSPMPPHG Sbjct: 1 MGSSDMDKTPKE-KESKTPP-ATSQEQSPPTTGMATINPDWSNFQAYSPMPPHG 52