BLASTX nr result
ID: Bupleurum21_contig00013689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00013689 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE91898.1| tobacco fibrillarin homolog [Nicotiana tabacum] 66 1e-20 emb|CAR92137.1| fibrillarin 2 [Nicotiana benthamiana] 65 1e-20 emb|CAK32531.1| fibrillarin 2 [Nicotiana benthamiana] 65 1e-20 ref|XP_002321930.1| predicted protein [Populus trichocarpa] gi|2... 65 5e-20 ref|XP_002513667.1| fibrillarin, putative [Ricinus communis] gi|... 66 7e-20 >dbj|BAE91898.1| tobacco fibrillarin homolog [Nicotiana tabacum] Length = 314 Score = 65.9 bits (159), Expect(2) = 1e-20 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = +2 Query: 266 VQNEDGTEVNYRVWDSSRSKLAAVILEGVDYFSIKPAVKVLYLGA 400 VQNEDGT+V YRVW+ RSKLAA IL GVD IKP KVLYLGA Sbjct: 115 VQNEDGTKVEYRVWNPFRSKLAAAILGGVDDIWIKPGAKVLYLGA 159 Score = 58.9 bits (141), Expect(2) = 1e-20 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = +3 Query: 69 GGEVVVVPHGQHEGLFIVNGQ---LCTKNLLPGKSVYNETLFPVQNEDGT 209 G +VVV PH +H G+FI G+ LCTKNL+PG++VYNE VQNEDGT Sbjct: 73 GNKVVVEPH-RHGGVFIAKGKEDALCTKNLVPGEAVYNEKRISVQNEDGT 121 >emb|CAR92137.1| fibrillarin 2 [Nicotiana benthamiana] Length = 314 Score = 65.5 bits (158), Expect(2) = 1e-20 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +2 Query: 266 VQNEDGTEVNYRVWDSSRSKLAAVILEGVDYFSIKPAVKVLYLGA 400 VQNEDGT+V YRVW+ RSKLAA +L GVD IKP KVLYLGA Sbjct: 115 VQNEDGTKVEYRVWNPFRSKLAAAVLGGVDDIWIKPGAKVLYLGA 159 Score = 58.9 bits (141), Expect(2) = 1e-20 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = +3 Query: 69 GGEVVVVPHGQHEGLFIVNGQ---LCTKNLLPGKSVYNETLFPVQNEDGT 209 G +VVV PH +H G+FI G+ LCTKNL+PG++VYNE VQNEDGT Sbjct: 73 GNKVVVEPH-RHGGVFIAKGKEDALCTKNLVPGEAVYNEKRISVQNEDGT 121 >emb|CAK32531.1| fibrillarin 2 [Nicotiana benthamiana] Length = 314 Score = 65.5 bits (158), Expect(2) = 1e-20 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +2 Query: 266 VQNEDGTEVNYRVWDSSRSKLAAVILEGVDYFSIKPAVKVLYLGA 400 VQNEDGT+V YRVW+ RSKLAA +L GVD IKP KVLYLGA Sbjct: 115 VQNEDGTKVEYRVWNPFRSKLAAAVLGGVDDIWIKPGAKVLYLGA 159 Score = 58.9 bits (141), Expect(2) = 1e-20 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = +3 Query: 69 GGEVVVVPHGQHEGLFIVNGQ---LCTKNLLPGKSVYNETLFPVQNEDGT 209 G +VVV PH +H G+FI G+ LCTKNL+PG++VYNE VQNEDGT Sbjct: 73 GNKVVVEPH-RHGGVFIAKGKEDALCTKNLVPGEAVYNEKRISVQNEDGT 121 >ref|XP_002321930.1| predicted protein [Populus trichocarpa] gi|222868926|gb|EEF06057.1| predicted protein [Populus trichocarpa] Length = 245 Score = 65.5 bits (158), Expect(2) = 5e-20 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = +2 Query: 266 VQNEDGTEVNYRVWDSSRSKLAAVILEGVDYFSIKPAVKVLYLGA 400 VQNEDGT+V YRVW+ RSKLAA IL GVD IKP KVLYLGA Sbjct: 46 VQNEDGTKVEYRVWNPFRSKLAAAILGGVDDVWIKPGAKVLYLGA 90 Score = 57.0 bits (136), Expect(2) = 5e-20 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 3/53 (5%) Frame = +3 Query: 60 LASGGEVVVVPHGQHEGLFIVNGQ---LCTKNLLPGKSVYNETLFPVQNEDGT 209 + G +VVV PH +HEG+FI G+ L TKN++PG++VYNE VQNEDGT Sbjct: 1 MRGGSKVVVEPH-RHEGVFIAKGKEDALVTKNMVPGETVYNEKKVSVQNEDGT 52 >ref|XP_002513667.1| fibrillarin, putative [Ricinus communis] gi|223547575|gb|EEF49070.1| fibrillarin, putative [Ricinus communis] Length = 247 Score = 66.2 bits (160), Expect(2) = 7e-20 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = +2 Query: 266 VQNEDGTEVNYRVWDSSRSKLAAVILEGVDYFSIKPAVKVLYLGA 400 VQNEDGT+V YRVW+ RSKLAA IL GVD IKP KVLYLGA Sbjct: 47 VQNEDGTKVEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGA 91 Score = 55.8 bits (133), Expect(2) = 7e-20 Identities = 30/54 (55%), Positives = 37/54 (68%), Gaps = 4/54 (7%) Frame = +3 Query: 60 LASGGEVVVVPHGQHEGLFIVNG----QLCTKNLLPGKSVYNETLFPVQNEDGT 209 + G +VVV PH +HEG+FI G L TKNL+PG++VYNE VQNEDGT Sbjct: 1 MRGGSKVVVEPH-RHEGVFIGKGGKEDALVTKNLVPGEAVYNEKRISVQNEDGT 53