BLASTX nr result
ID: Bupleurum21_contig00012780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00012780 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523634.1| OTU domain-containing protein, putative [Ric... 82 5e-25 dbj|BAB10951.1| unnamed protein product [Arabidopsis thaliana] 79 4e-21 gb|AAN17412.1| putative protein [Arabidopsis thaliana] gi|250842... 79 4e-21 ref|NP_201518.2| SEC-C motif-containing protein / OTU-like cyste... 79 4e-21 ref|NP_975005.1| SEC-C motif-containing protein / OTU-like cyste... 79 4e-21 >ref|XP_002523634.1| OTU domain-containing protein, putative [Ricinus communis] gi|223537196|gb|EEF38829.1| OTU domain-containing protein, putative [Ricinus communis] Length = 371 Score = 82.4 bits (202), Expect(2) = 5e-25 Identities = 42/69 (60%), Positives = 52/69 (75%) Frame = -1 Query: 207 KADADISMKTREAKVSVIKARGKADKYVIHAESIKMVMGGSGCEDAGKAEQVLLQVDGDI 28 KADAD+S T +AK + K++G A K I SIK+V+ GSGC+DA K EQVLLQVDGD+ Sbjct: 177 KADADLSATTCQAKTAASKSKGGAAKNSIDPSSIKVVIAGSGCQDAQKVEQVLLQVDGDV 236 Query: 27 DAAVEFLIA 1 DAA+EFL A Sbjct: 237 DAAIEFLRA 245 Score = 57.0 bits (136), Expect(2) = 5e-25 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -3 Query: 406 SYHDEEHYNSVRVKEDTCLGAARPVMIK 323 SYHDEEHYNSVR+KEDTC+G ARP++IK Sbjct: 150 SYHDEEHYNSVRLKEDTCIGPARPIIIK 177 >dbj|BAB10951.1| unnamed protein product [Arabidopsis thaliana] Length = 382 Score = 78.6 bits (192), Expect(2) = 4e-21 Identities = 38/69 (55%), Positives = 55/69 (79%) Frame = -1 Query: 207 KADADISMKTREAKVSVIKARGKADKYVIHAESIKMVMGGSGCEDAGKAEQVLLQVDGDI 28 +ADA +S +++AK + K++ KADK ++A +IK+VM GS C++ KAEQVLLQV+GD+ Sbjct: 182 EADAKVSAASKQAKATESKSKNKADKCHVNAGAIKVVMSGSCCDNTEKAEQVLLQVNGDV 241 Query: 27 DAAVEFLIA 1 DAA+EFLIA Sbjct: 242 DAAIEFLIA 250 Score = 47.8 bits (112), Expect(2) = 4e-21 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -3 Query: 406 SYHDEEHYNSVRVKEDTCLGAARPVMIK 323 SYHD EHYNSVR KED C G ARPV+I+ Sbjct: 155 SYHDGEHYNSVRSKEDACGGPARPVVIE 182 >gb|AAN17412.1| putative protein [Arabidopsis thaliana] gi|25084238|gb|AAN72203.1| putative protein [Arabidopsis thaliana] Length = 375 Score = 78.6 bits (192), Expect(2) = 4e-21 Identities = 38/69 (55%), Positives = 55/69 (79%) Frame = -1 Query: 207 KADADISMKTREAKVSVIKARGKADKYVIHAESIKMVMGGSGCEDAGKAEQVLLQVDGDI 28 +ADA +S +++AK + K++ KADK ++A +IK+VM GS C++ KAEQVLLQV+GD+ Sbjct: 175 EADAKVSAASKQAKATESKSKNKADKCHVNAGAIKVVMSGSCCDNTEKAEQVLLQVNGDV 234 Query: 27 DAAVEFLIA 1 DAA+EFLIA Sbjct: 235 DAAIEFLIA 243 Score = 47.8 bits (112), Expect(2) = 4e-21 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -3 Query: 406 SYHDEEHYNSVRVKEDTCLGAARPVMIK 323 SYHD EHYNSVR KED C G ARPV+I+ Sbjct: 148 SYHDGEHYNSVRSKEDACGGPARPVVIE 175 >ref|NP_201518.2| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] gi|332010926|gb|AED98309.1| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] gi|407078848|gb|AFS88955.1| OTU-containing deubiquitinating enzyme OTU7 isoform i [Arabidopsis thaliana] Length = 375 Score = 78.6 bits (192), Expect(2) = 4e-21 Identities = 38/69 (55%), Positives = 55/69 (79%) Frame = -1 Query: 207 KADADISMKTREAKVSVIKARGKADKYVIHAESIKMVMGGSGCEDAGKAEQVLLQVDGDI 28 +ADA +S +++AK + K++ KADK ++A +IK+VM GS C++ KAEQVLLQV+GD+ Sbjct: 175 EADAKVSAASKQAKATESKSKNKADKCHVNAGAIKVVMSGSCCDNTEKAEQVLLQVNGDV 234 Query: 27 DAAVEFLIA 1 DAA+EFLIA Sbjct: 235 DAAIEFLIA 243 Score = 47.8 bits (112), Expect(2) = 4e-21 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -3 Query: 406 SYHDEEHYNSVRVKEDTCLGAARPVMIK 323 SYHD EHYNSVR KED C G ARPV+I+ Sbjct: 148 SYHDGEHYNSVRSKEDACGGPARPVVIE 175 >ref|NP_975005.1| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] gi|332010927|gb|AED98310.1| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] Length = 374 Score = 78.6 bits (192), Expect(2) = 4e-21 Identities = 38/69 (55%), Positives = 55/69 (79%) Frame = -1 Query: 207 KADADISMKTREAKVSVIKARGKADKYVIHAESIKMVMGGSGCEDAGKAEQVLLQVDGDI 28 +ADA +S +++AK + K++ KADK ++A +IK+VM GS C++ KAEQVLLQV+GD+ Sbjct: 174 EADAKVSAASKQAKATESKSKNKADKCHVNAGAIKVVMSGSCCDNTEKAEQVLLQVNGDV 233 Query: 27 DAAVEFLIA 1 DAA+EFLIA Sbjct: 234 DAAIEFLIA 242 Score = 47.8 bits (112), Expect(2) = 4e-21 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -3 Query: 406 SYHDEEHYNSVRVKEDTCLGAARPVMIK 323 SYHD EHYNSVR KED C G ARPV+I+ Sbjct: 147 SYHDGEHYNSVRSKEDACGGPARPVVIE 174