BLASTX nr result
ID: Bupleurum21_contig00012479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00012479 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_181456.1| lateral organ junction protein [Arabidopsis tha... 60 1e-07 >ref|NP_181456.1| lateral organ junction protein [Arabidopsis thaliana] gi|75100007|sp|O80958.1|PP194_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g39230, mitochondrial; AltName: Full=Protein LATERAL ORGAN JUNCTION; Flags: Precursor gi|3402682|gb|AAC28985.1| unknown protein [Arabidopsis thaliana] gi|330254554|gb|AEC09648.1| lateral organ junction protein [Arabidopsis thaliana] Length = 867 Score = 60.5 bits (145), Expect = 1e-07 Identities = 41/129 (31%), Positives = 66/129 (51%) Frame = +3 Query: 36 NQETQTINPTTPQSNFTSQHHHEKPISKITALSENLTDPTRIDFDPTRLSEVLLSHKNDP 215 + +++ I+ +T ++ T + H+ + + L+ T T D R+ EVLL +NDP Sbjct: 36 DNQSRDISDSTTETISTLEFPHKTSVPNHSPLTS--TSETENHVDDARVIEVLLGRRNDP 93 Query: 216 DTAWNYFRSVELKSRSIVRNDPLCVLLHILATSENHHHILEKKISLFVSRNGRLIGPGIV 395 +A Y V+ R D VL+HIL +S + H + +FVS N LI +V Sbjct: 94 VSALQYCNWVKPLHRLCEGGDVFWVLIHILLSSIHTHDRASNLLVMFVSNNPTLIPNVMV 153 Query: 396 DQLVDSAKR 422 + LVDS+KR Sbjct: 154 NNLVDSSKR 162