BLASTX nr result
ID: Bupleurum21_contig00012452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00012452 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511737.1| conserved hypothetical protein [Ricinus comm... 97 2e-18 ref|XP_002273779.2| PREDICTED: uncharacterized protein LOC100260... 87 1e-15 emb|CBI38869.3| unnamed protein product [Vitis vinifera] 87 1e-15 emb|CAN79001.1| hypothetical protein VITISV_017257 [Vitis vinifera] 87 1e-15 ref|XP_003551633.1| PREDICTED: uncharacterized protein LOC100807... 84 9e-15 >ref|XP_002511737.1| conserved hypothetical protein [Ricinus communis] gi|223548917|gb|EEF50406.1| conserved hypothetical protein [Ricinus communis] Length = 900 Score = 96.7 bits (239), Expect = 2e-18 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 4/71 (5%) Frame = +2 Query: 98 CLYTIF----STNGTYINWVKLNKQSPESKLHHGDIVSFAAPPHHELAYAFVFREVLNCT 265 C +IF STNGTY+NW KL+K PESK+ HGDI+SFAAPP HELA+AFV+REVL Sbjct: 135 CQKSIFLKDTSTNGTYLNWKKLSKSGPESKVQHGDIISFAAPPQHELAFAFVYREVLRVA 194 Query: 266 PFSDGSLLKRK 298 PF +G+ +KRK Sbjct: 195 PFMEGAPVKRK 205 >ref|XP_002273779.2| PREDICTED: uncharacterized protein LOC100260735 [Vitis vinifera] Length = 910 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/62 (64%), Positives = 50/62 (80%) Frame = +2 Query: 116 STNGTYINWVKLNKQSPESKLHHGDIVSFAAPPHHELAYAFVFREVLNCTPFSDGSLLKR 295 STNGTY+NW KL K SPES LHHGDI+SFAAPP HE+A+ FV+R+VL +P + ++ KR Sbjct: 149 STNGTYLNWEKLKKNSPESMLHHGDIISFAAPPDHEIAFTFVYRDVLKSSPL-NVAVPKR 207 Query: 296 KA 301 KA Sbjct: 208 KA 209 >emb|CBI38869.3| unnamed protein product [Vitis vinifera] Length = 815 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/62 (64%), Positives = 50/62 (80%) Frame = +2 Query: 116 STNGTYINWVKLNKQSPESKLHHGDIVSFAAPPHHELAYAFVFREVLNCTPFSDGSLLKR 295 STNGTY+NW KL K SPES LHHGDI+SFAAPP HE+A+ FV+R+VL +P + ++ KR Sbjct: 149 STNGTYLNWEKLKKNSPESMLHHGDIISFAAPPDHEIAFTFVYRDVLKSSPL-NVAVPKR 207 Query: 296 KA 301 KA Sbjct: 208 KA 209 >emb|CAN79001.1| hypothetical protein VITISV_017257 [Vitis vinifera] Length = 431 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/62 (64%), Positives = 50/62 (80%) Frame = +2 Query: 116 STNGTYINWVKLNKQSPESKLHHGDIVSFAAPPHHELAYAFVFREVLNCTPFSDGSLLKR 295 STNGTY+NW KL K SPES LHHGDI+SFAAPP HE+A+ FV+R+VL +P + ++ KR Sbjct: 149 STNGTYLNWEKLKKNSPESMLHHGDIISFAAPPDHEIAFTFVYRDVLKSSPL-NVAVPKR 207 Query: 296 KA 301 KA Sbjct: 208 KA 209 >ref|XP_003551633.1| PREDICTED: uncharacterized protein LOC100807844 [Glycine max] Length = 881 Score = 84.3 bits (207), Expect = 9e-15 Identities = 38/62 (61%), Positives = 47/62 (75%) Frame = +2 Query: 116 STNGTYINWVKLNKQSPESKLHHGDIVSFAAPPHHELAYAFVFREVLNCTPFSDGSLLKR 295 STNGTY+NW KL K K+ HGDI+SFAAPP H+LA+AFV+REVL +P D ++ KR Sbjct: 127 STNGTYLNWEKLKKNGAAVKVCHGDIISFAAPPQHDLAFAFVYREVLVSSPMPDNAVAKR 186 Query: 296 KA 301 KA Sbjct: 187 KA 188