BLASTX nr result
ID: Bupleurum21_contig00011514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00011514 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148981.1| PREDICTED: uncharacterized protein LOC101206... 124 1e-26 ref|XP_002268140.1| PREDICTED: uncharacterized protein LOC100244... 123 1e-26 ref|XP_003517087.1| PREDICTED: uncharacterized protein LOC100500... 121 5e-26 gb|AFK45486.1| unknown [Lotus japonicus] 121 7e-26 gb|ABK23810.1| unknown [Picea sitchensis] 121 7e-26 >ref|XP_004148981.1| PREDICTED: uncharacterized protein LOC101206237 [Cucumis sativus] gi|449515019|ref|XP_004164547.1| PREDICTED: uncharacterized protein LOC101231828 [Cucumis sativus] Length = 68 Score = 124 bits (310), Expect = 1e-26 Identities = 59/67 (88%), Positives = 61/67 (91%) Frame = -2 Query: 359 MTRGKQKIEAQKKNAEKNQKGKGSQFEARAVALKVICPICKAQLANQNQLGDHYSAKHPK 180 MTRGKQKIEAQK+NAEKNQK KGSQ EARAVALKVICPICK QLANQNQLGDHY +KHPK Sbjct: 1 MTRGKQKIEAQKRNAEKNQKPKGSQLEARAVALKVICPICKVQLANQNQLGDHYGSKHPK 60 Query: 179 ETPPSNS 159 E PPS S Sbjct: 61 EKPPSES 67 >ref|XP_002268140.1| PREDICTED: uncharacterized protein LOC100244227 [Vitis vinifera] gi|296085504|emb|CBI29236.3| unnamed protein product [Vitis vinifera] Length = 68 Score = 123 bits (309), Expect = 1e-26 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = -2 Query: 359 MTRGKQKIEAQKKNAEKNQKGKGSQFEARAVALKVICPICKAQLANQNQLGDHYSAKHPK 180 MTRGKQKIEAQ++NAE+NQK KGSQFEARAVALK+ CPICK QLANQNQLGDHYS+KHPK Sbjct: 1 MTRGKQKIEAQRRNAERNQKPKGSQFEARAVALKITCPICKVQLANQNQLGDHYSSKHPK 60 Query: 179 ETPPSNS 159 E PPS+S Sbjct: 61 EKPPSDS 67 >ref|XP_003517087.1| PREDICTED: uncharacterized protein LOC100500226 [Glycine max] Length = 68 Score = 121 bits (304), Expect = 5e-26 Identities = 57/67 (85%), Positives = 62/67 (92%) Frame = -2 Query: 359 MTRGKQKIEAQKKNAEKNQKGKGSQFEARAVALKVICPICKAQLANQNQLGDHYSAKHPK 180 MTRGKQKIEAQK+NAE+NQKGKGSQ EARAV LKVICPICKAQLANQNQL DHY++KHPK Sbjct: 1 MTRGKQKIEAQKRNAERNQKGKGSQLEARAVGLKVICPICKAQLANQNQLVDHYASKHPK 60 Query: 179 ETPPSNS 159 E PP+ S Sbjct: 61 EKPPAES 67 >gb|AFK45486.1| unknown [Lotus japonicus] Length = 68 Score = 121 bits (303), Expect = 7e-26 Identities = 58/67 (86%), Positives = 60/67 (89%) Frame = -2 Query: 359 MTRGKQKIEAQKKNAEKNQKGKGSQFEARAVALKVICPICKAQLANQNQLGDHYSAKHPK 180 MTRGKQKIEAQKKNAEKNQKGKGSQ EARAV LKVICPICKAQLANQ QL DHY +KHPK Sbjct: 1 MTRGKQKIEAQKKNAEKNQKGKGSQLEARAVGLKVICPICKAQLANQKQLVDHYGSKHPK 60 Query: 179 ETPPSNS 159 E PP+ S Sbjct: 61 EEPPAES 67 >gb|ABK23810.1| unknown [Picea sitchensis] Length = 68 Score = 121 bits (303), Expect = 7e-26 Identities = 56/68 (82%), Positives = 60/68 (88%) Frame = -2 Query: 359 MTRGKQKIEAQKKNAEKNQKGKGSQFEARAVALKVICPICKAQLANQNQLGDHYSAKHPK 180 MTRGKQKIEAQ++NAEKNQK KGSQFEARA ALK CPICK QLANQNQ+GDHYS+KHPK Sbjct: 1 MTRGKQKIEAQRRNAEKNQKAKGSQFEARAAALKFTCPICKVQLANQNQIGDHYSSKHPK 60 Query: 179 ETPPSNSE 156 E PP SE Sbjct: 61 EKPPPQSE 68