BLASTX nr result
ID: Bupleurum21_contig00011468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00011468 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|2J89|A Chain A, Functional And Structural Aspects Of Poplar ... 102 3e-20 gb|AAS46232.1| methionine sulfoxide reductase A [Populus trichoc... 102 3e-20 gb|AEN03272.1| methionine sulfoxide reductase A4 [Solanum lycope... 102 4e-20 ref|XP_002867624.1| protein-methionine-s-oxide reductase [Arabid... 102 4e-20 gb|AAM65092.1| protein-methionine-S-oxide reductase [Arabidopsis... 102 4e-20 >pdb|2J89|A Chain A, Functional And Structural Aspects Of Poplar Cytosolic And Plastidial Type A Methionine Sulfoxide Reductases Length = 261 Score = 102 bits (254), Expect = 3e-20 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -1 Query: 205 KVLNRKIVTEILPAKKFYRAEEYHQQYLAKGGRLGLRQSAEKGCTDPIRCYG 50 K+LNRKIVTEILPAKKFYRAEEYHQQYLAKGGR G QSAEKGC DPIRCYG Sbjct: 210 KLLNRKIVTEILPAKKFYRAEEYHQQYLAKGGRFGFMQSAEKGCNDPIRCYG 261 >gb|AAS46232.1| methionine sulfoxide reductase A [Populus trichocarpa x Populus deltoides] Length = 261 Score = 102 bits (254), Expect = 3e-20 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -1 Query: 205 KVLNRKIVTEILPAKKFYRAEEYHQQYLAKGGRLGLRQSAEKGCTDPIRCYG 50 K+LNRKIVTEILPAKKFYRAEEYHQQYLAKGGR G QSAEKGC DPIRCYG Sbjct: 210 KLLNRKIVTEILPAKKFYRAEEYHQQYLAKGGRFGFMQSAEKGCNDPIRCYG 261 >gb|AEN03272.1| methionine sulfoxide reductase A4 [Solanum lycopersicum] Length = 257 Score = 102 bits (253), Expect = 4e-20 Identities = 46/52 (88%), Positives = 47/52 (90%) Frame = -1 Query: 205 KVLNRKIVTEILPAKKFYRAEEYHQQYLAKGGRLGLRQSAEKGCTDPIRCYG 50 K+LNR IVTEILPAKKFYRAEEYHQQYLAKGGR G RQS EKGC DPIRCYG Sbjct: 206 KILNRNIVTEILPAKKFYRAEEYHQQYLAKGGRFGFRQSVEKGCNDPIRCYG 257 >ref|XP_002867624.1| protein-methionine-s-oxide reductase [Arabidopsis lyrata subsp. lyrata] gi|297313460|gb|EFH43883.1| protein-methionine-s-oxide reductase [Arabidopsis lyrata subsp. lyrata] Length = 257 Score = 102 bits (253), Expect = 4e-20 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 205 KVLNRKIVTEILPAKKFYRAEEYHQQYLAKGGRLGLRQSAEKGCTDPIRCYG 50 K+LN+KIVTEILPA KFYRAE YHQQYLAKGGR+GLRQSAEKGC DPIRCYG Sbjct: 206 KILNKKIVTEILPATKFYRAENYHQQYLAKGGRMGLRQSAEKGCKDPIRCYG 257 >gb|AAM65092.1| protein-methionine-S-oxide reductase [Arabidopsis thaliana] Length = 258 Score = 102 bits (253), Expect = 4e-20 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 205 KVLNRKIVTEILPAKKFYRAEEYHQQYLAKGGRLGLRQSAEKGCTDPIRCYG 50 K+LN+KIVTEILPA KFYRAE YHQQYLAKGGR+GLRQSAEKGC DPIRCYG Sbjct: 207 KILNKKIVTEILPATKFYRAENYHQQYLAKGGRMGLRQSAEKGCKDPIRCYG 258