BLASTX nr result
ID: Bupleurum21_contig00011385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00011385 (776 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76054.1| hypothetical protein VITISV_036406 [Vitis vinifera] 64 3e-08 >emb|CAN76054.1| hypothetical protein VITISV_036406 [Vitis vinifera] Length = 289 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 588 MYIGITLRRYKAVKEVGKIKMSVGIVAYYQRMQICQ 481 MYI +TL+RY+AVKEVGKIKMSVGI+A+YQ MQ+CQ Sbjct: 1 MYIAVTLKRYRAVKEVGKIKMSVGIIAHYQLMQVCQ 36