BLASTX nr result
ID: Bupleurum21_contig00011320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00011320 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524933.1| PREDICTED: chaperone protein dnaJ 20, chloro... 57 1e-06 ref|NP_001235176.1| DnaJ-like protein [Glycine max] gi|146424720... 56 3e-06 >ref|XP_003524933.1| PREDICTED: chaperone protein dnaJ 20, chloroplastic-like [Glycine max] Length = 184 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/62 (53%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = -3 Query: 255 AVSARTRVNYH-QRTEEREEWKNRWASQLSELKKMRSNYSDT--RESWGSRMRRQHSE*K 85 A +AR R NYH Q E++ EWK RW SQLSELK+ RSN D SW +RMR+Q E Sbjct: 123 AFNARRRYNYHDQVVEQKSEWKVRWKSQLSELKR-RSNSKDVGGNMSWAARMRQQRDELS 181 Query: 84 TE 79 E Sbjct: 182 NE 183 >ref|NP_001235176.1| DnaJ-like protein [Glycine max] gi|146424720|dbj|BAF62127.1| DnaJ-like protein [Glycine max] Length = 186 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/62 (51%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = -3 Query: 255 AVSARTRVNYH-QRTEEREEWKNRWASQLSELKKMRSNYSDT--RESWGSRMRRQHSE*K 85 A +AR R NYH Q E++ EWK RW SQLSELK+ +SN D SW +RMR+Q E Sbjct: 125 AFNARRRYNYHDQVVEQKSEWKARWKSQLSELKR-KSNGKDAGGNMSWAARMRQQRDELS 183 Query: 84 TE 79 E Sbjct: 184 NE 185