BLASTX nr result
ID: Bupleurum21_contig00011254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00011254 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298205.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 ref|XP_002303194.1| predicted protein [Populus trichocarpa] gi|1... 73 3e-11 ref|XP_002530460.1| transcription cofactor, putative [Ricinus co... 71 1e-10 tpg|DAA48539.1| TPA: hypothetical protein ZEAMMB73_618405 [Zea m... 70 2e-10 gb|AFW61659.1| hypothetical protein ZEAMMB73_514492 [Zea mays] 70 2e-10 >ref|XP_002298205.1| predicted protein [Populus trichocarpa] gi|222845463|gb|EEE83010.1| predicted protein [Populus trichocarpa] Length = 123 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/58 (58%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +3 Query: 114 DWRNNVQPEYRRRIVNKIVDSLKRH-PFYAKMGSQELERIAIEFENKIYAESTSTSDY 284 DWR +QP+ R+RIVNKI+++LKRH PF + G QEL++IA+ FE KIY +TS SDY Sbjct: 21 DWRTQLQPDARQRIVNKIMETLKRHLPFSGQEGLQELKKIAVRFEEKIYTAATSQSDY 78 >ref|XP_002303194.1| predicted protein [Populus trichocarpa] gi|118486915|gb|ABK95291.1| unknown [Populus trichocarpa] gi|222840626|gb|EEE78173.1| predicted protein [Populus trichocarpa] Length = 101 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/58 (58%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +3 Query: 114 DWRNNVQPEYRRRIVNKIVDSLKRH-PFYAKMGSQELERIAIEFENKIYAESTSTSDY 284 DWR +QP+ R+RIVNKI+++LKRH PF + G QEL++IA+ FE KIY +TS SDY Sbjct: 5 DWRTQLQPDSRQRIVNKIMETLKRHLPFSGQEGLQELKKIAVRFEEKIYTAATSQSDY 62 >ref|XP_002530460.1| transcription cofactor, putative [Ricinus communis] gi|223530005|gb|EEF31930.1| transcription cofactor, putative [Ricinus communis] Length = 1382 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/58 (56%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +3 Query: 114 DWRNNVQPEYRRRIVNKIVDSLKRH-PFYAKMGSQELERIAIEFENKIYAESTSTSDY 284 DWR +QP+ R+RIVNKI+++LKRH PF + G +EL++IA+ FE KIY +TS SDY Sbjct: 21 DWRATLQPDSRQRIVNKIMETLKRHLPFSGQEGLEELKKIAVRFEEKIYTAATSQSDY 78 >tpg|DAA48539.1| TPA: hypothetical protein ZEAMMB73_618405 [Zea mays] Length = 540 Score = 70.1 bits (170), Expect = 2e-10 Identities = 35/72 (48%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +3 Query: 72 LGLMDNNYSRAIDDDWRNNVQPEYRRRIVNKIVDSLKRH-PFYAKMGSQELERIAIEFEN 248 +G +D N + DWR +QPE R+RIVNKI+++LK+H P G EL +IA+ FE Sbjct: 21 VGGVDPNAAAPTGSDWRTQLQPEARQRIVNKIMETLKKHLPVSVPEGLTELHKIAVRFEE 80 Query: 249 KIYAESTSTSDY 284 KIY +TS SDY Sbjct: 81 KIYTAATSQSDY 92 >gb|AFW61659.1| hypothetical protein ZEAMMB73_514492 [Zea mays] Length = 1308 Score = 70.1 bits (170), Expect = 2e-10 Identities = 37/79 (46%), Positives = 47/79 (59%), Gaps = 1/79 (1%) Frame = +3 Query: 51 TSLVDMDLGLMDNNYSRAIDDDWRNNVQPEYRRRIVNKIVDSLKRH-PFYAKMGSQELER 227 T D G +D N + DWR +QPE R RIVNKI+++LK+H P G EL + Sbjct: 10 TQGTDPAAGGVDPNAAAPAGSDWRTQLQPEARHRIVNKIMETLKKHLPVSVPEGLTELHK 69 Query: 228 IAIEFENKIYAESTSTSDY 284 IA+ FE KIY +TS SDY Sbjct: 70 IAVRFEEKIYTAATSQSDY 88