BLASTX nr result
ID: Bupleurum21_contig00011168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00011168 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533671.1| heparanase, putative [Ricinus communis] gi|2... 64 1e-08 ref|XP_004159389.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-l... 62 6e-08 ref|XP_004139281.1| PREDICTED: heparanase-like protein 3-like [C... 62 6e-08 emb|CBI25561.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002263173.1| PREDICTED: heparanase-like protein 3-like [V... 61 1e-07 >ref|XP_002533671.1| heparanase, putative [Ricinus communis] gi|223526439|gb|EEF28717.1| heparanase, putative [Ricinus communis] Length = 551 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -1 Query: 282 GKPLTVDQFGNIPLLNPQNISSSEPITVAPYSIVFVHLPVDLPACR 145 G L V+ G+IP L P ++SS+PITV P+SIVFVHLP DLPACR Sbjct: 506 GNILDVNSSGDIPTLEPLRVNSSQPITVTPFSIVFVHLPYDLPACR 551 >ref|XP_004159389.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-like protein 3-like [Cucumis sativus] Length = 539 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/47 (61%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 282 GKPLTVDQFGNIPLLNPQNISSSEPITVAPYSIVFVHLP-VDLPACR 145 G L+V+ GNIP L PQ+++SSEPI VAP+SIVF+H+P + LPACR Sbjct: 493 GNILSVNSSGNIPPLEPQHVNSSEPIMVAPFSIVFIHIPNIILPACR 539 >ref|XP_004139281.1| PREDICTED: heparanase-like protein 3-like [Cucumis sativus] Length = 539 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/47 (61%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 282 GKPLTVDQFGNIPLLNPQNISSSEPITVAPYSIVFVHLP-VDLPACR 145 G L+V+ GNIP L PQ+++SSEPI VAP+SIVF+H+P + LPACR Sbjct: 493 GNILSVNSSGNIPPLEPQHVNSSEPIMVAPFSIVFIHIPNIILPACR 539 >emb|CBI25561.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/47 (63%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -1 Query: 282 GKPLTVDQFGNIPLLNPQNISSSEPITVAPYSIVFVHLP-VDLPACR 145 G LTV+ G+IP L P N++SS PIT+AP+SIVFVH+P V LPACR Sbjct: 487 GNILTVNASGDIPPLEPLNVNSSSPITIAPFSIVFVHMPSVVLPACR 533 >ref|XP_002263173.1| PREDICTED: heparanase-like protein 3-like [Vitis vinifera] Length = 559 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/47 (63%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -1 Query: 282 GKPLTVDQFGNIPLLNPQNISSSEPITVAPYSIVFVHLP-VDLPACR 145 G LTV+ G+IP L P N++SS PIT+AP+SIVFVH+P V LPACR Sbjct: 513 GNILTVNASGDIPPLEPLNVNSSSPITIAPFSIVFVHMPSVVLPACR 559