BLASTX nr result
ID: Bupleurum21_contig00011094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00011094 (335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM65139.1| GATA transcription factor 1 (AtGATA-1) [Arabidops... 62 4e-08 ref|NP_189047.1| GATA transcription factor 1 [Arabidopsis thalia... 62 4e-08 ref|XP_002885621.1| hypothetical protein ARALYDRAFT_479930 [Arab... 62 4e-08 dbj|BAE99493.1| GATA transcription factor 1 [Arabidopsis thaliana] 62 4e-08 ref|XP_004150343.1| PREDICTED: GATA transcription factor 1-like ... 61 1e-07 >gb|AAM65139.1| GATA transcription factor 1 (AtGATA-1) [Arabidopsis thaliana] Length = 268 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 3 VPEYRPASSPTFSSELHSNSHRKIVEMRRRVHGGD 107 VPEYRPA+SPTF++ELHSNSHRKIVEMR++ GD Sbjct: 225 VPEYRPANSPTFTAELHSNSHRKIVEMRKQYQSGD 259 >ref|NP_189047.1| GATA transcription factor 1 [Arabidopsis thaliana] gi|62900367|sp|Q8LAU9.2|GATA1_ARATH RecName: Full=GATA transcription factor 1; Short=AtGATA-1 gi|2959730|emb|CAA73999.1| homologous to GATA-binding transcription factors [Arabidopsis thaliana] gi|9294674|dbj|BAB03023.1| protein homologous to GATA-binding transcription factors [Arabidopsis thaliana] gi|87116628|gb|ABD19678.1| At3g24050 [Arabidopsis thaliana] gi|332643327|gb|AEE76848.1| GATA transcription factor 1 [Arabidopsis thaliana] Length = 274 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 3 VPEYRPASSPTFSSELHSNSHRKIVEMRRRVHGGD 107 VPEYRPA+SPTF++ELHSNSHRKIVEMR++ GD Sbjct: 231 VPEYRPANSPTFTAELHSNSHRKIVEMRKQYQSGD 265 >ref|XP_002885621.1| hypothetical protein ARALYDRAFT_479930 [Arabidopsis lyrata subsp. lyrata] gi|297331461|gb|EFH61880.1| hypothetical protein ARALYDRAFT_479930 [Arabidopsis lyrata subsp. lyrata] Length = 270 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 3 VPEYRPASSPTFSSELHSNSHRKIVEMRRRVHGGD 107 VPEYRPA+SPTF++ELHSNSHRKIVEMR++ GD Sbjct: 229 VPEYRPANSPTFTAELHSNSHRKIVEMRKQYQSGD 263 >dbj|BAE99493.1| GATA transcription factor 1 [Arabidopsis thaliana] Length = 134 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 3 VPEYRPASSPTFSSELHSNSHRKIVEMRRRVHGGD 107 VPEYRPA+SPTF++ELHSNSHRKIVEMR++ GD Sbjct: 91 VPEYRPANSPTFTAELHSNSHRKIVEMRKQYQSGD 125 >ref|XP_004150343.1| PREDICTED: GATA transcription factor 1-like [Cucumis sativus] gi|449514819|ref|XP_004164489.1| PREDICTED: GATA transcription factor 1-like [Cucumis sativus] Length = 287 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 3 VPEYRPASSPTFSSELHSNSHRKIVEMRRRVHGGDVM 113 VPEYRPASSPTFS+ELHSNSHRK++EMRR+ G V+ Sbjct: 245 VPEYRPASSPTFSAELHSNSHRKVMEMRRQKQLGMVV 281