BLASTX nr result
ID: Bupleurum21_contig00011051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00011051 (561 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264570.1| PREDICTED: large subunit GTPase 1 homolog [V... 108 4e-22 ref|XP_002313500.1| predicted protein [Populus trichocarpa] gi|2... 99 6e-19 ref|NP_172317.1| P-loop containing nucleoside triphosphate hydro... 97 1e-18 ref|XP_002889691.1| GTP-binding family protein [Arabidopsis lyra... 96 3e-18 ref|XP_004173318.1| PREDICTED: large subunit GTPase 1-like [Cucu... 93 3e-17 >ref|XP_002264570.1| PREDICTED: large subunit GTPase 1 homolog [Vitis vinifera] Length = 597 Score = 108 bits (271), Expect = 4e-22 Identities = 50/84 (59%), Positives = 65/84 (77%) Frame = -3 Query: 553 EGENEKGPSLEHVLDDLSSFDIDHGLASSKALTKKKPSGPSHKQHKKPQRSKNRSWRVKD 374 E E+E P+LEHVL+DL +FD+ +GLAS KA +K P P HKQHKKPQR K+RSWRVK+ Sbjct: 515 ESESESAPNLEHVLNDLDAFDMANGLASKKAPVQKTPKAP-HKQHKKPQRKKDRSWRVKN 573 Query: 373 NGDDGMAIVKVFQKPLNSRPVEAG 302 + DDGM + +VFQKP+N+ P+ G Sbjct: 574 DEDDGMPVARVFQKPVNTGPLNVG 597 >ref|XP_002313500.1| predicted protein [Populus trichocarpa] gi|222849908|gb|EEE87455.1| predicted protein [Populus trichocarpa] Length = 603 Score = 98.6 bits (244), Expect = 6e-19 Identities = 47/87 (54%), Positives = 66/87 (75%), Gaps = 3/87 (3%) Frame = -3 Query: 553 EGENEKGPSLEHVLDDLSSFDIDHGLASSKALTKKKPSGP---SHKQHKKPQRSKNRSWR 383 E + + P+LEHVLDDL+SFD+ +GLA K +T KKPS SHK HKKPQ+ K+RSWR Sbjct: 518 ENDGKNTPALEHVLDDLNSFDMANGLAHKK-VTVKKPSASASASHKHHKKPQKKKDRSWR 576 Query: 382 VKDNGDDGMAIVKVFQKPLNSRPVEAG 302 ++++G DGM +V+VFQK +N+ P++ G Sbjct: 577 IENDGGDGMPVVRVFQKSVNTGPLKTG 603 >ref|NP_172317.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|6664306|gb|AAF22888.1|AC006932_5 T27G7.9 [Arabidopsis thaliana] gi|66792666|gb|AAY56435.1| At1g08410 [Arabidopsis thaliana] gi|133778880|gb|ABO38780.1| At1g08410 [Arabidopsis thaliana] gi|332190165|gb|AEE28286.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] Length = 589 Score = 97.4 bits (241), Expect = 1e-18 Identities = 50/82 (60%), Positives = 63/82 (76%), Gaps = 1/82 (1%) Frame = -3 Query: 553 EGENEKGPSLEHVLDDLSSFDIDHGLASSKALTKKKPSGPSHKQHKKPQRSKNRSWRVKD 374 E ENE+ P ++ VLDDLSSFD+ +GL SSK +T KK + SHKQHKKPQR K+R+WRV++ Sbjct: 506 ETENEQVPGIDDVLDDLSSFDLANGLKSSKKVTAKKQTA-SHKQHKKPQRKKDRTWRVQN 564 Query: 373 NGD-DGMAIVKVFQKPLNSRPV 311 D DGM VKVFQKP N+ P+ Sbjct: 565 TEDGDGMPSVKVFQKPANTGPL 586 >ref|XP_002889691.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata] gi|297335533|gb|EFH65950.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata] Length = 583 Score = 96.3 bits (238), Expect = 3e-18 Identities = 49/82 (59%), Positives = 64/82 (78%), Gaps = 1/82 (1%) Frame = -3 Query: 553 EGENEKGPSLEHVLDDLSSFDIDHGLASSKALTKKKPSGPSHKQHKKPQRSKNRSWRVKD 374 E E+E+ P ++ VLDDLSSFD+ +GL SSK +T KK + SHKQHKKPQR K+R+WRV++ Sbjct: 500 ETESEQVPGIDAVLDDLSSFDLANGLKSSKKVTAKKQTA-SHKQHKKPQRKKDRTWRVQN 558 Query: 373 NGD-DGMAIVKVFQKPLNSRPV 311 D DGM +VKVFQKP N+ P+ Sbjct: 559 TEDGDGMPMVKVFQKPANTGPL 580 >ref|XP_004173318.1| PREDICTED: large subunit GTPase 1-like [Cucumis sativus] Length = 376 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/80 (52%), Positives = 54/80 (67%) Frame = -3 Query: 547 ENEKGPSLEHVLDDLSSFDIDHGLASSKALTKKKPSGPSHKQHKKPQRSKNRSWRVKDNG 368 + E GP E V D L SFD+ +GLA +T+KK SHK HKKPQR K RSWR+ ++G Sbjct: 296 DGENGPGFEQVADYLDSFDLANGLAKPNIITEKKAKASSHKHHKKPQRKKERSWRMGNDG 355 Query: 367 DDGMAIVKVFQKPLNSRPVE 308 DGM V+V QKP+NS P++ Sbjct: 356 GDGMPAVRVLQKPINSGPLK 375