BLASTX nr result
ID: Bupleurum21_contig00010920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00010920 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601633.1| Branchpoint-bridging protein [Medicago trunc... 56 3e-06 >ref|XP_003601633.1| Branchpoint-bridging protein [Medicago truncatula] gi|355490681|gb|AES71884.1| Branchpoint-bridging protein [Medicago truncatula] Length = 637 Score = 56.2 bits (134), Expect = 3e-06 Identities = 36/83 (43%), Positives = 47/83 (56%), Gaps = 8/83 (9%) Frame = +3 Query: 6 PPVQNFAPQPLMQGFSRPQVINHTNLPPPYMSSP----STGNLRFPNGPPRHPAFPGAGP 173 PP + P +Q F R QV N + Y+S+ S+G++ FP PRHPAFP AG Sbjct: 492 PPFRFAVPDQPLQSFQRTQVSNQLDPDQAYVSAAPFGGSSGSVSFP---PRHPAFPYAGQ 548 Query: 174 LSPATS--QMGMRNF--SPQVMN 230 SP + QMGMRNF +PQ+ N Sbjct: 549 PSPRSQVPQMGMRNFIPAPQMQN 571