BLASTX nr result
ID: Bupleurum21_contig00010914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00010914 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q8GSN8.1|3MAT_DAHPI RecName: Full=Malonyl-coenzyme A:anthocya... 73 3e-11 gb|AAO12207.1| putative malonyl CoA:anthocyanidin 3-O-glucoside-... 71 8e-11 ref|XP_002326110.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_002326109.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_002336610.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 >sp|Q8GSN8.1|3MAT_DAHPI RecName: Full=Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase; Short=Dv3MaT; Short=Malonyl CoA:anthocyanin 3-O-glucoside-6''-O-malonyltransferase gi|27372443|gb|AAO12206.1| malonyl CoA:anthocyanin 3-O-glucoside-6''-O-malonyltransferase [Dahlia pinnata] Length = 460 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/60 (53%), Positives = 41/60 (68%) Frame = +3 Query: 288 PNTVAQTSLPLTFFDLLWLNFTPFSRLLFYDLKLTTTNFTQQHLPNLKKSLSMALQHYFP 467 P+T+ SLPLTFFD+ WL F P L FY + ++FT+ +PNLK SLS+ LQHYFP Sbjct: 19 PSTIGHRSLPLTFFDIAWLLFPPVHHLYFYHFPYSKSHFTETVIPNLKHSLSITLQHYFP 78 >gb|AAO12207.1| putative malonyl CoA:anthocyanidin 3-O-glucoside-6''-O-malonyltransferase [Dahlia pinnata] Length = 467 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/62 (51%), Positives = 41/62 (66%) Frame = +3 Query: 288 PNTVAQTSLPLTFFDLLWLNFTPFSRLLFYDLKLTTTNFTQQHLPNLKKSLSMALQHYFP 467 PNTV + +LPLT FDL+WL F P +L FYD ++F +P LK SLS+ LQH+FP Sbjct: 22 PNTVGERTLPLTLFDLVWLIFHPIHQLFFYDFPYPKSHFIDTIIPKLKHSLSVTLQHFFP 81 Query: 468 LA 473 A Sbjct: 82 FA 83 >ref|XP_002326110.1| predicted protein [Populus trichocarpa] gi|222862985|gb|EEF00492.1| predicted protein [Populus trichocarpa] Length = 466 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/62 (56%), Positives = 41/62 (66%) Frame = +3 Query: 288 PNTVAQTSLPLTFFDLLWLNFTPFSRLLFYDLKLTTTNFTQQHLPNLKKSLSMALQHYFP 467 P +V TSLPLTFFD W P RL FY+L T F + LP+LK SLS+ALQH+FP Sbjct: 19 PGSVPTTSLPLTFFDFPWHLCPPMERLFFYELPYPTLYFMHKILPSLKNSLSLALQHFFP 78 Query: 468 LA 473 LA Sbjct: 79 LA 80 >ref|XP_002326109.1| predicted protein [Populus trichocarpa] gi|222862984|gb|EEF00491.1| predicted protein [Populus trichocarpa] Length = 466 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/62 (56%), Positives = 41/62 (66%) Frame = +3 Query: 288 PNTVAQTSLPLTFFDLLWLNFTPFSRLLFYDLKLTTTNFTQQHLPNLKKSLSMALQHYFP 467 P +V TSLPLTFFD W P RL FY+L T F + LP+LK SLS+ALQH+FP Sbjct: 19 PGSVPTTSLPLTFFDFPWHLCPPMERLFFYELPYPTLYFMHKILPSLKNSLSLALQHFFP 78 Query: 468 LA 473 LA Sbjct: 79 LA 80 >ref|XP_002336610.1| predicted protein [Populus trichocarpa] gi|222836314|gb|EEE74735.1| predicted protein [Populus trichocarpa] Length = 467 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/62 (56%), Positives = 39/62 (62%) Frame = +3 Query: 288 PNTVAQTSLPLTFFDLLWLNFTPFSRLLFYDLKLTTTNFTQQHLPNLKKSLSMALQHYFP 467 P +V TSLPLTFFD WL P RL FY+ T FT LP LK SLS+ LQH+FP Sbjct: 19 PGSVPTTSLPLTFFDFPWLLCRPMERLFFYEFPYPTLYFTNNILPILKNSLSLTLQHFFP 78 Query: 468 LA 473 LA Sbjct: 79 LA 80