BLASTX nr result
ID: Bupleurum21_contig00010837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00010837 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269140.2| PREDICTED: B3 domain-containing protein Os11... 55 5e-06 emb|CAN64872.1| hypothetical protein VITISV_026093 [Vitis vinifera] 55 5e-06 >ref|XP_002269140.2| PREDICTED: B3 domain-containing protein Os11g0197600-like [Vitis vinifera] Length = 598 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Frame = -1 Query: 196 KMNPSFFKPLIRDFAEKLQIPPAFVEKFGEHFDANWVLK--CEKSYEVMTEEWDGRHYIR 23 + NPSFFK LI DF KL+IPPAF++KF N VLK +S+ V ++ D ++ + Sbjct: 6 RRNPSFFKVLIGDFTNKLRIPPAFMKKFRRMTFNNAVLKTVTGESWMVSVKQEDSCYFFK 65 Query: 22 NGWPLFV 2 GW FV Sbjct: 66 KGWRKFV 72 >emb|CAN64872.1| hypothetical protein VITISV_026093 [Vitis vinifera] Length = 262 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Frame = -1 Query: 196 KMNPSFFKPLIRDFAEKLQIPPAFVEKFGEHFDANWVLK--CEKSYEVMTEEWDGRHYIR 23 + NPSFFK LI DF KL+IPPAF++KF N VLK +S+ V ++ D ++ + Sbjct: 6 RRNPSFFKVLIGDFTNKLRIPPAFMKKFRRMTFNNAVLKTVTGESWMVSVKQEDSCYFFK 65 Query: 22 NGWPLFV 2 GW FV Sbjct: 66 KGWRKFV 72