BLASTX nr result
ID: Bupleurum21_contig00010775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00010775 (440 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304832.1| hypothetical protein POPTRDRAFT_555141 [Popu... 64 2e-08 emb|CBI25240.3| unnamed protein product [Vitis vinifera] 62 4e-08 ref|XP_002332086.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 emb|CAN68167.1| hypothetical protein VITISV_043694 [Vitis vinifera] 62 4e-08 ref|XP_002515336.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002304832.1| hypothetical protein POPTRDRAFT_555141 [Populus trichocarpa] gi|222842264|gb|EEE79811.1| hypothetical protein POPTRDRAFT_555141 [Populus trichocarpa] Length = 350 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +3 Query: 6 PISMQNFKVAMELNPQQLGEDWPLMLERICTHAYNE 113 PIS+ +FKVAMELNPQ+LGEDWPL+LE+ICTH E Sbjct: 315 PISLLDFKVAMELNPQELGEDWPLLLEKICTHPSEE 350 >emb|CBI25240.3| unnamed protein product [Vitis vinifera] Length = 275 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 6 PISMQNFKVAMELNPQQLGEDWPLMLERICTHAYNE 113 P+S+ +FKVAMELNPQQLGEDWPL+LE+I TH + E Sbjct: 240 PVSLLDFKVAMELNPQQLGEDWPLLLEKISTHPFEE 275 >ref|XP_002332086.1| predicted protein [Populus trichocarpa] gi|222874906|gb|EEF12037.1| predicted protein [Populus trichocarpa] Length = 384 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +3 Query: 9 ISMQNFKVAMELNPQQLGEDWPLMLERICTHAYNE 113 ISM +FKVAMELNPQQLGEDWPL+LE+IC H++ + Sbjct: 350 ISMLDFKVAMELNPQQLGEDWPLLLEKICMHSFED 384 >emb|CAN68167.1| hypothetical protein VITISV_043694 [Vitis vinifera] Length = 212 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 6 PISMQNFKVAMELNPQQLGEDWPLMLERICTHAYNE 113 P+S+ +FKVAMELNPQQLGEDWPL+LE+I TH + E Sbjct: 177 PVSLLDFKVAMELNPQQLGEDWPLLLEKISTHPFEE 212 >ref|XP_002515336.1| conserved hypothetical protein [Ricinus communis] gi|223545280|gb|EEF46785.1| conserved hypothetical protein [Ricinus communis] Length = 419 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +3 Query: 9 ISMQNFKVAMELNPQQLGEDWPLMLERICTHAYNE 113 IS+ +FKVAMELNPQQLGEDW L+LE+IC HA+ + Sbjct: 385 ISLLDFKVAMELNPQQLGEDWSLLLEKICMHAFED 419