BLASTX nr result
ID: Bupleurum21_contig00010727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00010727 (586 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containi... 132 3e-29 ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycin... 130 2e-28 emb|CBI24493.3| unnamed protein product [Vitis vinifera] 129 5e-28 ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containi... 129 5e-28 ref|XP_002321854.1| predicted protein [Populus trichocarpa] gi|2... 127 2e-27 >ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Glycine max] Length = 113 Score = 132 bits (333), Expect = 3e-29 Identities = 64/78 (82%), Positives = 70/78 (89%), Gaps = 2/78 (2%) Frame = -1 Query: 436 GGKFNRTVRVRAE--SINPEIRKSEEKVVDSVDLTQLSKPITPYCRCWRSKTFPLCDGSH 263 GG+ R V V+AE SINP+IRKSEEKVVDSV +T+LSKP+TPYCRCWRS TFPLCDGSH Sbjct: 36 GGRPRRVVLVKAEAVSINPDIRKSEEKVVDSVVVTELSKPLTPYCRCWRSGTFPLCDGSH 95 Query: 262 VKHNKATGDNVGPLLLKK 209 VKHNKATGDNVGPLLLKK Sbjct: 96 VKHNKATGDNVGPLLLKK 113 >ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycine max] gi|255628565|gb|ACU14627.1| unknown [Glycine max] Length = 113 Score = 130 bits (327), Expect = 2e-28 Identities = 65/81 (80%), Positives = 71/81 (87%), Gaps = 3/81 (3%) Frame = -1 Query: 442 GSGG-KFNRTVRVRAE--SINPEIRKSEEKVVDSVDLTQLSKPITPYCRCWRSKTFPLCD 272 G GG + R V V+AE SINP+IRKSEEKVVDSV +T+LSKP+TPYCRCWRS TFPLCD Sbjct: 33 GVGGVRTRRVVLVKAEAVSINPDIRKSEEKVVDSVVVTELSKPLTPYCRCWRSGTFPLCD 92 Query: 271 GSHVKHNKATGDNVGPLLLKK 209 GSHVKHNKATGDNVGPLLLKK Sbjct: 93 GSHVKHNKATGDNVGPLLLKK 113 >emb|CBI24493.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 129 bits (323), Expect = 5e-28 Identities = 61/77 (79%), Positives = 66/77 (85%) Frame = -1 Query: 439 SGGKFNRTVRVRAESINPEIRKSEEKVVDSVDLTQLSKPITPYCRCWRSKTFPLCDGSHV 260 S G R V VRAE+INPEIRK EEKVVDSV + +L+KP+T YCRCWRS TFPLCDGSHV Sbjct: 21 SSGAARRAVVVRAETINPEIRKIEEKVVDSVLVAELAKPVTAYCRCWRSGTFPLCDGSHV 80 Query: 259 KHNKATGDNVGPLLLKK 209 KHNKATGDNVGPLLLKK Sbjct: 81 KHNKATGDNVGPLLLKK 97 >ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Vitis vinifera] Length = 117 Score = 129 bits (323), Expect = 5e-28 Identities = 61/77 (79%), Positives = 66/77 (85%) Frame = -1 Query: 439 SGGKFNRTVRVRAESINPEIRKSEEKVVDSVDLTQLSKPITPYCRCWRSKTFPLCDGSHV 260 S G R V VRAE+INPEIRK EEKVVDSV + +L+KP+T YCRCWRS TFPLCDGSHV Sbjct: 41 SSGAARRAVVVRAETINPEIRKIEEKVVDSVLVAELAKPVTAYCRCWRSGTFPLCDGSHV 100 Query: 259 KHNKATGDNVGPLLLKK 209 KHNKATGDNVGPLLLKK Sbjct: 101 KHNKATGDNVGPLLLKK 117 >ref|XP_002321854.1| predicted protein [Populus trichocarpa] gi|222868850|gb|EEF05981.1| predicted protein [Populus trichocarpa] Length = 168 Score = 127 bits (318), Expect = 2e-27 Identities = 58/70 (82%), Positives = 64/70 (91%) Frame = -1 Query: 415 VRVRAESINPEIRKSEEKVVDSVDLTQLSKPITPYCRCWRSKTFPLCDGSHVKHNKATGD 236 VR A+SINPEIRK+EEKVVDSV + +LSKP+T YCRCWRS TFPLCDGSHVKHNKATGD Sbjct: 97 VRAEAQSINPEIRKNEEKVVDSVVVAELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGD 156 Query: 235 NVGPLLLKKE 206 NVGPLLLKK+ Sbjct: 157 NVGPLLLKKQ 166