BLASTX nr result
ID: Bupleurum21_contig00010692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00010692 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265359.2| PREDICTED: cyclin-dependent kinase F-4-like ... 59 5e-07 ref|XP_003547727.1| PREDICTED: cyclin-dependent kinase F-4-like ... 58 7e-07 ref|XP_003612616.1| Serine/threonine protein kinase ICK [Medicag... 57 2e-06 ref|XP_003547829.1| PREDICTED: cyclin-dependent kinase F-4-like ... 57 2e-06 ref|XP_003534312.1| PREDICTED: cyclin-dependent kinase F-4-like ... 56 3e-06 >ref|XP_002265359.2| PREDICTED: cyclin-dependent kinase F-4-like [Vitis vinifera] gi|296088459|emb|CBI37450.3| unnamed protein product [Vitis vinifera] Length = 452 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 91 ISCRKLLCSWDPCKRPTALEVLQHPFFQSC 2 IS LCSWDPCKRPTALE LQHPFFQSC Sbjct: 257 ISLITSLCSWDPCKRPTALEALQHPFFQSC 286 >ref|XP_003547727.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max] Length = 450 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 91 ISCRKLLCSWDPCKRPTALEVLQHPFFQSC 2 IS LCSWDPCKRPTA EVLQHPFFQSC Sbjct: 257 ISLVTSLCSWDPCKRPTAAEVLQHPFFQSC 286 >ref|XP_003612616.1| Serine/threonine protein kinase ICK [Medicago truncatula] gi|355513951|gb|AES95574.1| Serine/threonine protein kinase ICK [Medicago truncatula] Length = 449 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -1 Query: 91 ISCRKLLCSWDPCKRPTALEVLQHPFFQSC 2 IS + LCSWDPCKRPTA E LQHPFFQSC Sbjct: 257 ISLIQSLCSWDPCKRPTASEALQHPFFQSC 286 >ref|XP_003547829.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max] Length = 414 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 91 ISCRKLLCSWDPCKRPTALEVLQHPFFQSC 2 IS LCSWDPCKRPTA E LQHPFFQSC Sbjct: 257 ISLVTSLCSWDPCKRPTAAEALQHPFFQSC 286 >ref|XP_003534312.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max] Length = 455 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 91 ISCRKLLCSWDPCKRPTALEVLQHPFFQSC 2 IS LCSWDPCKRPTA E LQHPFFQSC Sbjct: 257 ISLITSLCSWDPCKRPTASEALQHPFFQSC 286