BLASTX nr result
ID: Bupleurum21_contig00010619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00010619 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135335.1| PREDICTED: cysteine synthase, chloroplastic/... 57 2e-06 ref|XP_004167180.1| PREDICTED: cysteine synthase, chloroplastic/... 55 5e-06 >ref|XP_004135335.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like [Cucumis sativus] Length = 390 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 5/72 (6%) Frame = +3 Query: 75 PLTTSAYSSKSQLFIHANCLT-----PNFINLKKNVLLPSSPIVCKAVSVEPQSETKALN 239 PL++S +SKS L + + T P+ ++ K+ L + + CKAVS++PQ+E + LN Sbjct: 13 PLSSSVSNSKSSLLLFNSPPTSLRILPSLLHSSKSNLHATLSVTCKAVSIKPQTEIEDLN 72 Query: 240 IAQDVTQLIGKT 275 IA DVTQL+GKT Sbjct: 73 IASDVTQLVGKT 84 >ref|XP_004167180.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like [Cucumis sativus] Length = 390 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/72 (41%), Positives = 47/72 (65%), Gaps = 5/72 (6%) Frame = +3 Query: 75 PLTTSAYSSKSQLFIHANCLT-----PNFINLKKNVLLPSSPIVCKAVSVEPQSETKALN 239 PL++S +S+S L + + T P+ ++ K+ L + + CKAVS++PQ+E + LN Sbjct: 13 PLSSSVSNSESSLLLFNSPPTSLRILPSLLHSSKSNLHATLSVTCKAVSIKPQTEIEDLN 72 Query: 240 IAQDVTQLIGKT 275 IA DVTQL+GKT Sbjct: 73 IASDVTQLVGKT 84