BLASTX nr result
ID: Bupleurum21_contig00010166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00010166 (764 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523376.1| 14-3-3 protein, putative [Ricinus communis] ... 81 2e-16 ref|XP_002330721.1| predicted protein [Populus trichocarpa] gi|8... 80 2e-16 ref|XP_002285427.1| PREDICTED: 14-3-3-like protein D-like [Vitis... 80 2e-16 ref|NP_001234272.1| 14-3-3 protein 9 [Solanum lycopersicum] gi|2... 83 4e-16 gb|AAC15418.1| 14-3-3 protein homolog [Maackia amurensis] 80 4e-16 >ref|XP_002523376.1| 14-3-3 protein, putative [Ricinus communis] gi|223537326|gb|EEF38955.1| 14-3-3 protein, putative [Ricinus communis] Length = 260 Score = 80.9 bits (198), Expect(2) = 2e-16 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 764 ELAPTHPIRLGLALNFSVFYFEIMNSPERACSLAKQAFDEA 642 EL PTHPIRLGLALNFSVFY+EIMNSPERAC LAKQAFDEA Sbjct: 165 ELPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEA 205 Score = 31.2 bits (69), Expect(2) = 2e-16 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 535 LWTSDIPEDGED 500 LWTSDIPEDGED Sbjct: 233 LWTSDIPEDGED 244 >ref|XP_002330721.1| predicted protein [Populus trichocarpa] gi|8515890|gb|AAF76227.1|AF272573_1 14-3-3 protein [Populus tremula x Populus alba] gi|222872497|gb|EEF09628.1| predicted protein [Populus trichocarpa] Length = 260 Score = 80.5 bits (197), Expect(2) = 2e-16 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 764 ELAPTHPIRLGLALNFSVFYFEIMNSPERACSLAKQAFDEA 642 +L+PTHPIRLGLALNFSVFY+EIMNSPERAC LAKQAFDEA Sbjct: 165 DLSPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEA 205 Score = 31.2 bits (69), Expect(2) = 2e-16 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 535 LWTSDIPEDGED 500 LWTSDIPEDGED Sbjct: 233 LWTSDIPEDGED 244 >ref|XP_002285427.1| PREDICTED: 14-3-3-like protein D-like [Vitis vinifera] Length = 254 Score = 80.5 bits (197), Expect(2) = 2e-16 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 764 ELAPTHPIRLGLALNFSVFYFEIMNSPERACSLAKQAFDEA 642 +L+PTHPIRLGLALNFSVFY+EIMNSPERAC LAKQAFDEA Sbjct: 161 DLSPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEA 201 Score = 31.2 bits (69), Expect(2) = 2e-16 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 535 LWTSDIPEDGED 500 LWTSDIPEDGED Sbjct: 229 LWTSDIPEDGED 240 >ref|NP_001234272.1| 14-3-3 protein 9 [Solanum lycopersicum] gi|26454611|sp|P93214.2|14339_SOLLC RecName: Full=14-3-3 protein 9 gi|22138738|emb|CAA67373.2| 14-3-3 protein [Solanum lycopersicum] Length = 261 Score = 82.8 bits (203), Expect(2) = 4e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 764 ELAPTHPIRLGLALNFSVFYFEIMNSPERACSLAKQAFDEA 642 ELAPTHPIRLGLALNFSVFY+EIMNSPERAC LAKQAFDEA Sbjct: 165 ELAPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEA 205 Score = 28.1 bits (61), Expect(2) = 4e-16 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 535 LWTSDIPEDGED 500 LWTSD+PED ED Sbjct: 233 LWTSDLPEDAED 244 >gb|AAC15418.1| 14-3-3 protein homolog [Maackia amurensis] Length = 261 Score = 79.7 bits (195), Expect(2) = 4e-16 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 764 ELAPTHPIRLGLALNFSVFYFEIMNSPERACSLAKQAFDEA 642 EL PTHPIRLGLALNFSVFY+EI+NSPERAC LAKQAFDEA Sbjct: 165 ELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEA 205 Score = 31.2 bits (69), Expect(2) = 4e-16 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 535 LWTSDIPEDGED 500 LWTSDIPEDGED Sbjct: 233 LWTSDIPEDGED 244