BLASTX nr result
ID: Bupleurum21_contig00009675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00009675 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABZ89191.1| putative protein [Coffea canephora] 72 4e-11 ref|XP_002312910.1| cytochrome P450 [Populus trichocarpa] gi|222... 65 4e-09 ref|XP_002306227.1| cytochrome P450 [Populus trichocarpa] gi|222... 65 4e-09 ref|XP_002510669.1| cytochrome P450, putative [Ricinus communis]... 64 2e-08 ref|XP_002526166.1| cytochrome P450, putative [Ricinus communis]... 62 4e-08 >gb|ABZ89191.1| putative protein [Coffea canephora] Length = 450 Score = 72.4 bits (176), Expect = 4e-11 Identities = 40/112 (35%), Positives = 58/112 (51%), Gaps = 30/112 (26%) Frame = +2 Query: 20 DVKSSEVIKYIRDLSLRHFGVETVRTKLLPQMEVVVSKTLESWSKSDSVELKSKAI---- 187 D S KY R L+L HFGVE+++ KLLPQME +V +TL WS +S+E+K A+ Sbjct: 96 DQASQSSKKYTRHLTLSHFGVESLKEKLLPQMEDMVCETLRKWSSEESIEVKGAAVTVSI 155 Query: 188 --------------------------EMTISFSIRQILSADLDNTPVKLGEL 265 +MTI+F+ +QI S DL+N P+ + E+ Sbjct: 156 ELNHLPCMTNTWLHVQELHFDIFLPWQMTINFAAKQIFSGDLENAPLNISEM 207 >ref|XP_002312910.1| cytochrome P450 [Populus trichocarpa] gi|222849318|gb|EEE86865.1| cytochrome P450 [Populus trichocarpa] Length = 543 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/73 (39%), Positives = 48/73 (65%) Frame = +2 Query: 44 KYIRDLSLRHFGVETVRTKLLPQMEVVVSKTLESWSKSDSVELKSKAIEMTISFSIRQIL 223 KY R L+L HFG E+++ +LLPQ+E +VSK+L+ WS + S+++K M F+ +Q+ Sbjct: 129 KYARSLTLTHFGSESLKERLLPQVENIVSKSLQMWSSNGSIDVKPAVSIMVCDFTAKQLF 188 Query: 224 SADLDNTPVKLGE 262 D +N+ K+ E Sbjct: 189 RYDAENSSDKISE 201 >ref|XP_002306227.1| cytochrome P450 [Populus trichocarpa] gi|222849191|gb|EEE86738.1| cytochrome P450 [Populus trichocarpa] Length = 486 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/73 (41%), Positives = 47/73 (64%) Frame = +2 Query: 44 KYIRDLSLRHFGVETVRTKLLPQMEVVVSKTLESWSKSDSVELKSKAIEMTISFSIRQIL 223 KY R L+L HFG E+++ +LLPQ+E +VSK+L+ WS SV++K M F+ +Q+ Sbjct: 129 KYARSLTLTHFGSESLKERLLPQVENIVSKSLQMWSSDASVDVKPAVSIMVCDFTAKQLF 188 Query: 224 SADLDNTPVKLGE 262 D +N+ K+ E Sbjct: 189 GYDAENSSDKISE 201 >ref|XP_002510669.1| cytochrome P450, putative [Ricinus communis] gi|223551370|gb|EEF52856.1| cytochrome P450, putative [Ricinus communis] Length = 479 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/79 (37%), Positives = 47/79 (59%) Frame = +2 Query: 26 KSSEVIKYIRDLSLRHFGVETVRTKLLPQMEVVVSKTLESWSKSDSVELKSKAIEMTISF 205 K + KY+R+L L HFG E ++ KLLPQ+E + + L+ WSK S+E KS + M F Sbjct: 127 KHGSIHKYLRNLVLGHFGPEPLKEKLLPQLETGIRQRLQIWSKQPSIEAKSASSAMIFDF 186 Query: 206 SIRQILSADLDNTPVKLGE 262 + + + S D + + +GE Sbjct: 187 TAKVLFSYDPEKSKENIGE 205 >ref|XP_002526166.1| cytochrome P450, putative [Ricinus communis] gi|223534543|gb|EEF36242.1| cytochrome P450, putative [Ricinus communis] Length = 406 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/75 (40%), Positives = 46/75 (61%) Frame = +2 Query: 38 VIKYIRDLSLRHFGVETVRTKLLPQMEVVVSKTLESWSKSDSVELKSKAIEMTISFSIRQ 217 V K+I+ L HFG E ++ KLLPQ+E +V+ +L++WSK +SVE+K M + F+ + Sbjct: 57 VHKHIKKLISEHFGPERLKAKLLPQLEEMVNNSLQAWSKQESVEVKHACSRMILDFTSKL 116 Query: 218 ILSADLDNTPVKLGE 262 + S D N L E Sbjct: 117 LFSYDTGNNEESLSE 131